1ogp

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE OXIDASE

ARABIDOPSIS THALIANA

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CESIUM ION × 4 GLYCEROL × 2 (MOLYBDOPTERIN-S,S)-DIOXO-THIO-MOLYBDENUM(VI) × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	CESIUM ION × 4 GLYCEROL × 2 (MOLYBDOPTERIN-S,S)-DIOXO-THIO-MOLYBDENUM(VI) × 2 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	CESIUM ION × 4 GLYCEROL × 2 (MOLYBDOPTERIN-S,S)-DIOXO-THIO-MOLYBDENUM(VI) × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9S850
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–393； UniProt 1–393 Author chain B； PDBConstruct 1–393； UniProt 1–393 Author chain C； PDBConstruct 1–393； UniProt 1–393 Author chain D； PDBConstruct 1–393； UniProt 1–393 Author chain E； PDBConstruct 1–393； UniProt 1–393 Author chain F； PDBConstruct 1–393； UniProt 1–393

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ogp
Deposition date deposition_date	2003-05-08
Structure title title	The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Keywords keywords	;OXIDOREDUCTASE, MOLYBDENUM COFACTOR, MOLYBDOPTERIN, PLANT SULFITE OXIDASE, PEROXISOMES, INTRAMOLECULAR ELECTRON TRANSFER, OXIDOREDUCTAS ;; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ogp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ogp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ogp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.31 Å
Rg (electron density)	26.60 Å
Total Rg	27.43 Å
Atom count	6098
Residues	776
Excluded volume	108540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ogp__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ogp__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1ogp__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	SULFITE OXIDASE
Molecular weight formula_weight	43381.1 kDa
EC 编号 ec_number	1.8.3.1
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	18888

MPGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLGHSNL

Source Source

Source organism organism	ARABIDOPSIS THALIANA
Common name common_name	MOUSE-EAR CRESS
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	CESIUM ION
Molecular weight formula_weight	132.9 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	(MOLYBDOPTERIN-S,S)-DIOXO-THIO-MOLYBDENUM(VI)
Molecular weight formula_weight	517.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	594

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d1ogpa1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpa2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

Domain ID domain_id	d1ogpb1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

Domain ID domain_id	d1ogpc1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

Domain ID domain_id	d1ogpd1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

Domain ID domain_id	d1ogpe1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpe2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

Domain ID domain_id	d1ogpf1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.18 — E set domains
Family Family family	b.1.18.6 — Molybdenum-containing oxidoreductases-like dimerisation domain

Domain ID domain_id	d1ogpf2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.176 — Oxidoreductase molybdopterin-binding domain
Superfamily Superfamily superfamily	d.176.1 — Oxidoreductase molybdopterin-binding domain
Family Family family	d.176.1.1 — Oxidoreductase molybdopterin-binding domain

CATH v4.4 (12 domains)

Domain ID domain_id	1ogpA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

Domain ID domain_id	1ogpB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

Domain ID domain_id	1ogpC01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

Domain ID domain_id	1ogpD01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

Domain ID domain_id	1ogpE01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpE02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

Domain ID domain_id	1ogpF01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	420 — Sulfite Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Oxidoreductase, molybdopterin-binding domain

Domain ID domain_id	1ogpF02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	650 —

▶

Unit-cell length a length_a	222.918 Å
Unit-cell length b length_b	351.271 Å
Unit-cell length c length_c	158.282 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	182.570 Å
R factor r_factor	0.2370
R_work r_work	0.2350
R_free r_free	0.2660

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ogp__assembly_1__model_1

1ogp__assembly_1__model_1 | I(q)

1ogp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ogp__assembly_1__model_1

1ogp__assembly_1__model_1 | I(q)

1ogp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)