1ojh

Crystal structure of NblA from PCC 7120

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBLA

ANABAENA SP. PCC 7120

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8YNP7_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–65； UniProt 1–65 Author chain B； PDBConstruct 1–65； UniProt 1–65 Author chain C； PDBConstruct 1–65； UniProt 1–65 Author chain D； PDBConstruct 1–65； UniProt 1–65 Author chain E； PDBConstruct 1–65； UniProt 1–65 Author chain F； PDBConstruct 1–65； UniProt 1–65 Author chain G； PDBConstruct 1–65； UniProt 1–65 Author chain H； PDBConstruct 1–65； UniProt 1–65 Author chain I； PDBConstruct 1–65； UniProt 1–65 Author chain J； PDBConstruct 1–65； UniProt 1–65 Author chain K； PDBConstruct 1–65； UniProt 1–65 Author chain L； PDBConstruct 1–65； UniProt 1–65

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ojh
Deposition date deposition_date	2003-07-10
Structure title title	Crystal structure of NblA from PCC 7120
Keywords keywords	DEGRADATION PROTEIN, PHYCOBILISOME DEGRADATION, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ojh__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ojh__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ojh__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.86 Å
Rg (electron density)	15.89 Å
Total Rg	16.54 Å
Atom count	873
Residues	101
Excluded volume	15519 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ojh__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ojh__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1ojh__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1ojh__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1ojh__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1ojh__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	NBLA
Molecular weight formula_weight	7690.1 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	5444

MNQPIELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQWGLDSGSTPA

Source Source

Source organism organism	ANABAENA SP. PCC 7120
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	254

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d1ojha_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhb_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhc_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhd_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhe_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhf_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhg_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhh_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhi_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhj_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhk_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

Domain ID domain_id	d1ojhl_
Class class	a — All alpha proteins
Fold Fold fold	a.214 — NblA-like
Superfamily Superfamily superfamily	a.214.1 — NblA-like
Family Family family	a.214.1.1 — NblA-like

CATH v4.4 (12 domains)

Domain ID domain_id	1ojhA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

Domain ID domain_id	1ojhL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	670 — Phycobilisome degradation protein NblA

▶

Unit-cell length a length_a	43.176 Å
Unit-cell length b length_b	95.918 Å
Unit-cell length c length_c	104.835 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.05 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1840
R_work r_work	0.1820
R_free r_free	0.2170

Crystal structure of NblA from PCC 7120

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBLA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ojh__assembly_5__model_1

1ojh__assembly_5__model_1 | I(q)

1ojh__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (3)

Crystal structure of NblA from PCC 7120

1. Protein Identity and Related Structures Protein Identity & Related Structures

NBLA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ojh__assembly_5__model_1

1ojh__assembly_5__model_1 | I(q)

1ojh__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (3)