1rh7

Crystal Structure of Resistin-like beta

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Resistin-like beta

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	PLATINUM (II) ION × 3 HEXAETHYLENE GLYCOL × 2 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	PLATINUM (II) ION × 3 water × 3	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 6	PLATINUM (II) ION × 6 HEXAETHYLENE GLYCOL × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSNB_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–81； UniProt 25–105 Author chain B； PDBConstruct 1–81； UniProt 25–105 Author chain C； PDBConstruct 1–81； UniProt 25–105 Author chain D； PDBConstruct 1–81； UniProt 25–105 Author chain E； PDBConstruct 1–81； UniProt 25–105 Author chain F； PDBConstruct 1–81； UniProt 25–105

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1rh7
Deposition date deposition_date	2003-11-13
Structure title title	Crystal Structure of Resistin-like beta
Keywords keywords	;HORMONE; GLUCOSE UPTAKE; RESISTIN/FIZZ FAMILY, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HORMONE-GROWTH FACTOR COMPLEX ;; HORMONE/GROWTH FACTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1rh7__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1rh7__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1rh7__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.08 Å
Rg (electron density)	21.56 Å
Total Rg	21.53 Å
Atom count	1648
Residues	243
Excluded volume	28711 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1rh7__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1rh7__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1rh7__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Resistin-like beta
Molecular weight formula_weight	8642.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	3475

CSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 non-polymer

Description description	PLATINUM (II) ION
Molecular weight formula_weight	195.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	HEXAETHYLENE GLYCOL
Molecular weight formula_weight	282.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	140

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1rh7a_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

Domain ID domain_id	d1rh7b_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

Domain ID domain_id	d1rh7c_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

Domain ID domain_id	d1rh7d_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

Domain ID domain_id	d1rh7e_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

Domain ID domain_id	d1rh7f_
Class class	g — Small proteins
Fold Fold fold	g.77 — Resistin
Superfamily Superfamily superfamily	g.77.1 — Resistin
Family Family family	g.77.1.1 — Resistin

CATH v4.4 (12 domains)

Domain ID domain_id	1rh7A01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

Domain ID domain_id	1rh7B01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

Domain ID domain_id	1rh7C01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7C02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

Domain ID domain_id	1rh7D01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7D02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

Domain ID domain_id	1rh7E01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7E02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

Domain ID domain_id	1rh7F01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	1rh7F02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	4230 — Resistin head domain

▶

Unit-cell length a length_a	57.604 Å
Unit-cell length b length_b	86.016 Å
Unit-cell length c length_c	283.406 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	3.106 Å
Low-resolution limit resolution_low	14.960 Å
R factor r_factor	0.2043
R_work r_work	0.2012
R_free r_free	0.2638

Crystal Structure of Resistin-like beta

1. Protein Identity and Related Structures Protein Identity & Related Structures

Resistin-like beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rh7__assembly_2__model_1

1rh7__assembly_2__model_1 | I(q)

1rh7__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (6 domains)

CATH v4.4 (12 domains)

7. Citations (1)

Crystal Structure of Resistin-like beta

1. Protein Identity and Related Structures Protein Identity & Related Structures

Resistin-like beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rh7__assembly_2__model_1

1rh7__assembly_2__model_1 | I(q)

1rh7__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (6 domains)

CATH v4.4 (12 domains)

7. Citations (1)