1rqf

Structure of CK2 beta subunit crystallized in the presence of a p21WAF1 peptide

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Casein kinase II beta chain

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Disordered segment of Cyclin-dependent kinase inhibitor 1 × 2 ZINC ION × 2 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Disordered segment of Cyclin-dependent kinase inhibitor 1 × 1 Disordered segment of Cyclin-dependent kinase inhibitor 1 × 1 ZINC ION × 2 UNKNOWN LIGAND × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 2 UNKNOWN LIGAND × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Disordered segment of Cyclin-dependent kinase inhibitor 1 × 1 Disordered segment of Cyclin-dependent kinase inhibitor 1 × 1 ZINC ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KC2B_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–184； UniProt 1–178 Author chain B； PDBConstruct 7–184； UniProt 1–178 Author chain D； PDBConstruct 7–184； UniProt 1–178 Author chain E； PDBConstruct 7–184； UniProt 1–178 Author chain G； PDBConstruct 7–184； UniProt 1–178 Author chain H； PDBConstruct 7–184； UniProt 1–178 Author chain J； PDBConstruct 7–184； UniProt 1–178 Author chain K； PDBConstruct 7–184； UniProt 1–178

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1rqf
Deposition date deposition_date	2003-12-05
Structure title title	Structure of CK2 beta subunit crystallized in the presence of a p21WAF1 peptide
Keywords keywords	CASEIN KINASE BETA SUBUNIT, SER/THR PROTEIN KINASE, CYCLIN-DEPENDENT KINASE INHIBITOR, ZN FINGER, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1rqf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1rqf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1rqf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.82 Å
Rg (electron density)	26.61 Å
Total Rg	27.01 Å
Atom count	2801
Residues	345
Excluded volume	49538 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1rqf__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1rqf__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1rqf__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1rqf__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Casein kinase II beta chain
Molecular weight formula_weight	21260.0 kDa
EC 编号 ec_number	2.7.1.37
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,E,G,H,J,K
Atom count atom_count	11216

GSPGIQMSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKR

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Disordered segment of Cyclin-dependent kinase inhibitor 1
Molecular weight formula_weight	358.4 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,T

XXXX

Entity 3 Entity 3 polymer

Description description	Disordered segment of Cyclin-dependent kinase inhibitor 1
Molecular weight formula_weight	698.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

XXXXXXXX

Entity 4 Entity 4 polymer

Description description	Disordered segment of Cyclin-dependent kinase inhibitor 1
Molecular weight formula_weight	273.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,S

XXX

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 non-polymer

Description description	UNKNOWN LIGAND
Molecular weight formula_weight	103.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	65

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1rqfa_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfb_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfd_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfe_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfg_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfh_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfj_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

Domain ID domain_id	d1rqfk_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.4 — Casein kinase II beta subunit
Family Family family	g.41.4.1 — Casein kinase II beta subunit

CATH v4.4 (16 domains)

Domain ID domain_id	1rqfA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfA02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfB02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfD02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfE02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfG01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfG02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfH01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfH02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfJ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfJ02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1rqfK01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1820 — protein kinase ck2 holoenzyme, chain C, domain 1
Homologous superfamily homologous superfamily	10 — protein kinase ck2 holoenzyme, chain C, domain 1

Domain ID domain_id	1rqfK02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	145.422 Å
Unit-cell length b length_b	170.626 Å
Unit-cell length c length_c	74.546 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.890 Å
Low-resolution limit resolution_low	11.970 Å
R factor r_factor	0.2400
R_work r_work	0.2380
R_free r_free	0.2660

Structure of CK2 beta subunit crystallized in the presence of a p21WAF1 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Casein kinase II beta chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rqf__assembly_1__model_1

1rqf__assembly_1__model_1 | I(q)

1rqf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (8 domains)

CATH v4.4 (16 domains)

7. Citations (1)

Structure of CK2 beta subunit crystallized in the presence of a p21WAF1 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Casein kinase II beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rqf__assembly_1__model_1

1rqf__assembly_1__model_1 | I(q)

1rqf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (8 domains)

CATH v4.4 (16 domains)

7. Citations (1)