SAXSdb — 1szh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Her-1 protein

Caenorhabditis elegans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ACETATE ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	ACETATE ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HER1_CAEEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–161； UniProt 19–175 Author chain B； PDBConstruct 5–161； UniProt 19–175

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1szh
Deposition date deposition_date	2004-04-05
Structure title title	Crystal Structure of C. elegans HER-1
Keywords keywords	extended 3-10 helix; left-handed anti-parallel 4-helix bundle, overhand 3-helix bundle, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1szh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1szh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1szh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.15 Å
Rg (electron density)	16.29 Å
Total Rg	17.23 Å
Atom count	1174
Residues	147
Excluded volume	20934 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1szh__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1szh__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Her-1 protein
Molecular weight formula_weight	18426.3 kDa
Mutation mutation	N98E, N163E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2564

GSSSTLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEATFIQKRTFRGV

Source Source

Source organism organism	Caenorhabditis elegans
NCBI taxonomy ID ncbi_taxonomy_id	6239
Host organism host_organism	Cricetulus griseus

Entity 2 Entity 2 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	243

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1szha1
Class class	a — All alpha proteins
Fold Fold fold	a.226 — Her-1
Superfamily Superfamily superfamily	a.226.1 — Her-1
Family Family family	a.226.1.1 — Her-1

Domain ID domain_id	d1szha2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1szhb_
Class class	a — All alpha proteins
Fold Fold fold	a.226 — Her-1
Superfamily Superfamily superfamily	a.226.1 — Her-1
Family Family family	a.226.1.1 — Her-1

CATH v4.4 (4 domains)

Domain ID domain_id	1szhA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	1szhA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	370 — Caenorhabditis elegans Her-1, C-terminal domain

Domain ID domain_id	1szhB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	360 —

Domain ID domain_id	1szhB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	370 — Caenorhabditis elegans Her-1, C-terminal domain

▶

Unit-cell length a length_a	52.970 Å
Unit-cell length b length_b	58.930 Å
Unit-cell length c length_c	99.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.500 Å
Low-resolution limit resolution_low	29.460 Å
R factor r_factor	0.2090
R_work r_work	0.2090
R_free r_free	0.2270

Crystal Structure of C. elegans HER-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Her-1 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1szh__assembly_1__model_1

1szh__assembly_1__model_1 | I(q)

1szh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of C. elegans HER-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Her-1 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1szh__assembly_1__model_1

1szh__assembly_1__model_1 | I(q)

1szh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

7. Citations (1)