1tok

Maleic acid-bound structure of SRHEPT mutant of E. coli aspartate aminotransferase

Method: X-RAY DIFFRACTION D_max: 95.7 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aspartate aminotransferase

Escherichia coli

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–396 Chain B； UniProt 1–396	Mutation：A12T,P13T,N34D,T109S,G261A,S285G,N297S Non-standard monomer：Yes (specific site not provided by mmCIF)	MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；potassium phosphate, PLP, EDTA, DTT, PEG 400, N-methylmorpholine, ammonium sulfate, maleic acid, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.85 Å R-free 0.227

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1TOK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AAM THE STRUCTURAL BASIS FOR THE ALTERED SUBSTRATE SPECIFICITY OF THE R292D ACTIVE SITE MUTANT OF ASPARTATE AMINOTRANSFERASE FROM E. COLI Deposited 1993-07-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：R280D Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions SUBTILISIN CRYSTALS WERE CROSS-LINKED WITH GLUTARALDEHYDE AND PLACED IN ANHYDROUS ACETONITRILE PRIOR TO DATA COLLECTION.	Resolution 2.80 Å
1AAW THE STRUCTURAL BASIS FOR THE ALTERED SUBSTRATE SPECIFICITY OF THE R292D ACTIVE SITE MUTANT OF ASPARTATE AMINOTRANSFERASE FROM E. COLI Deposited 1993-07-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1AHE ASPARTATE AMINOTRANSFERASE HEXAMUTANT Deposited 1995-02-22	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：V39L, K41Y, T47I, N69L, T109S, N297S Mutation：V39L, K41Y, T47I, N69L, T109S, N297S	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1AHF ASPARTATE AMINOTRANSFERASE HEXAMUTANT Deposited 1995-02-22	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：V39L, K41Y, T47I, N69L, T109S, N297S Mutation：V39L, K41Y, T47I, N69L, T109S, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 IOP INDOLYLPROPIONIC ACID × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1AHG ASPARTATE AMINOTRANSFERASE HEXAMUTANT Deposited 1995-02-22	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	TYR TYROSINE × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1AHX ASPARTATE AMINOTRANSFERASE HEXAMUTANT Deposited 1995-02-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：V39L, K41Y, T47I, N69L, T109S, N297S Mutation：V39L, K41Y, T47I, N69L, T109S, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 HCI HYDROCINNAMIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1AHY ASPARTATE AMINOTRANSFERASE HEXAMUTANT Deposited 1995-02-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：V39L, K41Y, T47I, N69L, T109S, N297S Mutation：V39L, K41Y, T47I, N69L, T109S, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1AIA STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING THE PYRIDOXAL-5'-PHOSPHATE BINDING LYSINE RESIDUE Deposited 1994-05-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：K246H Mutation：K246H	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1AIB STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING THE PYRIDOXAL-5'-PHOSPHATE BINDING LYSINE RESIDUE Deposited 1994-05-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：K246H Mutation：K246H	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 AKG 2-OXOGLUTARIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1AIC STRUCTURAL BASIS FOR THE CATALYTIC ACTIVITY OF ASPARTATE AMINOTRANSFERASE K258H LACKING THE PYRIDOXAL-5'-PHOSPHATE BINDING LYSINE RESIDUE Deposited 1994-05-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：K246H Mutation：K246H	SO4 SULFATE ION × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1AMQ X-RAY CRYSTALLOGRAPHIC STUDY OF PYRIDOXAMINE 5'-PHOSPHATE-TYPE ASPARTATE AMINOTRANSFERASES FROM ESCHERICHIA COLI IN THREE FORMS Deposited 1994-07-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1AMR X-RAY CRYSTALLOGRAPHIC STUDY OF PYRIDOXAMINE 5'-PHOSPHATE-TYPE ASPARTATE AMINOTRANSFERASES FROM ESCHERICHIA COLI IN THREE FORMS Deposited 1994-07-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.10 Å
1AMS X-RAY CRYSTALLOGRAPHIC STUDY OF PYRIDOXAMINE 5'-PHOSPHATE-TYPE ASPARTATE AMINOTRANSFERASES FROM ESCHERICHIA COLI IN THREE FORMS Deposited 1994-07-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GUA GLUTARIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
1ARG Aspartate aminotransferase, phospho-5'-pyridoxyl aspartate complex Deposited 1995-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PPD 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYLENE)-AMINO]-SUCCINIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.20 Å
1ARH ASPARTATE AMINOTRANSFERASE, Y225R/R386A MUTANT Deposited 1995-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：Y225R, R386A Mutation：Y225R, R386A	PPD 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYLENE)-AMINO]-SUCCINIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.30 Å
1ARI Aspartate aminotransferase, W140H mutant, maleate complex Deposited 1995-08-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：W140H Mutation：W140H	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.30 Å
1ARS X-RAY CRYSTALLOGRAPHIC STUDY OF PYRIDOXAL 5'-PHOSPHATE-TYPE ASPARTATE AMINOTRANSFERASES FROM ESCHERICHIA COLI IN OPEN AND CLOSED FORM Deposited 1993-08-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
1ART X-RAY CRYSTALLOGRAPHIC STUDY OF PYRIDOXAL 5'-PHOSPHATE-TYPE ASPARTATE AMINOTRANSFERASES FROM ESCHERICHIA COLI IN OPEN AND CLOSED FORM Deposited 1993-08-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 0A0 2-methyl-L-aspartic acid × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
1ASA THE STRUCTURAL BASIS FOR THE REDUCED ACTIVITY OF THE Y226F(Y225F) ACTIVE SITE MUTANT OF E. COLI ASPARTATE AMINOTRANSFERASE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1ASB THE STRUCTURAL BASIS FOR THE REDUCED ACTIVITY OF THE D223A(D222A) ACTIVE SITE MUTANT OF E. COLI ASPARTATE AMINOTRANSFERASE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：D211A	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å
1ASC THE STRUCTURAL BASIS FOR THE REDUCED ACTIVITY OF THE D223A(D222A) ACTIVE SITE MUTANT OF E. COLI ASPARTATE AMINOTRANSFERASE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：D211A	NPL N-METHYL-4-DEOXY-4-AMINO-PYRIDOXAL-5-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1ASD THE STRUCTURE OF WILD TYPE E. COLI ASPARTATE AMINOTRANSFERASE RECONSTITUTED WITH N-MEPLP Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	MPL N-METHYL-PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1ASE THE STRUCTURE OF WILD TYPE E. COLI ASPARTATE AMINOTRANSFERASE RECONSTITUTED WITH PLP-N-OXIDE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	NOP PYRIDOXAL-5'-PHOSPHATE-N-OXIDE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1ASF THE STRUCTURAL BASIS FOR THE REDUCED ACTIVITY OF THE Y226F(Y225F) ACTIVE SITE MUTANT OF E. COLI ASPARTATE AMINOTRANSFERASE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：Y214F	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1ASG THE STRUCTURAL BASIS FOR THE REDUCED ACTIVITY OF THE Y226F(Y225F) ACTIVE SITE MUTANT OF E. COLI ASPARTATE AMINOTRANSFERASE Deposited 1993-08-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：Y214F	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1ASL CRYSTAL STRUCTURES OF ESCHERICHIA COLI ASPARTATE AMINOTRANSFERASE IN TWO CONFORMATIONS: COMPARISON OF AN UNLIGANDED OPEN AND TWO LIGANDED CLOSED FORMS Deposited 1993-09-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PLA 2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å
1ASM CRYSTAL STRUCTURES OF ESCHERICHIA COLI ASPARTATE AMINOTRANSFERASE IN TWO CONFORMATIONS: COMPARISON OF AN UNLIGANDED OPEN AND TWO LIGANDED CLOSED FORMS Deposited 1993-09-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.35 Å
1ASN CRYSTAL STRUCTURES OF ESCHERICHIA COLI ASPARTATE AMINOTRANSFERASE IN TWO CONFORMATIONS: COMPARISON OF AN UNLIGANDED OPEN AND TWO LIGANDED CLOSED FORMS Deposited 1993-09-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1B4X ASPARTATE AMINOTRANSFERASE FROM E. COLI, C191S MUTATION, WITH BOUND MALEATE Deposited 1998-12-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Fragment：COMPLETE SUBUNIT	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 2.45 Å
1BQA ASPARTATE AMINOTRANSFERASE P195A MUTANT Deposited 1998-08-13	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：P195A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：P195A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.10 Å R-free 0.230
1BQD ASPARTATE AMINOTRANSFERASE P138A/P195A DOUBLE MUTANT Deposited 1998-08-14	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：P138A, P195A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：P138A, P195A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.10 Å R-free 0.240
1C9C ASPARTATE AMINOTRANSFERASE COMPLEXED WITH C3-PYRIDOXAL-5'-PHOSPHATE Deposited 1999-08-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PP3 ALANYL-PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；ammonium sulfate, potassium phosphate, C3-pyridoxal-5p-phosphate, sodium azide, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.269
1CQ6 ASPARTATE AMINOTRANSFERASE COMPLEX WITH C4-PYRIDOXAL-5P-PHOSPHATE Deposited 1999-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PY4 2-[O-PHOSPHONOPYRIDOXYL]-AMINO- BUTYRIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；ammonium sulfate, potassium phosphate, C4-pyridoxal-5p-phosphate, sodium azide , pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.297
1CQ7 ASPARTATE AMINOTRANSFERASE (E.C. 2.6.1.1) COMPLEXED WITH C5-PYRIDOXAL-5P-PHOSPHATE Deposited 1999-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PY5 2-[O-PHOSPHONOPYRIDOXYL]-AMINO-PENTANOIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；ammonium sulfate, potassium phosphate, C4-pyridoxal-5p-phosphate,sodium azide , pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.251
1CQ8 ASPARTATE AMINOTRANSFERASE (E.C. 2.6.1.1) COMPLEXED WITH C6-PYRIDOXAL-5P-PHOSPHATE Deposited 1999-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PY6 2-[O-PHOSPHONOPYRIDOXYL]-AMINO-HEXANOIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；ammonium sulfate, potassium phosphate, C6-pyridoxal-5p-phosphate,sodium azide, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.270
1CZC ASPARTATE AMINOTRANSFERASE MUTANT ATB17/139S/142N WITH GLUTARIC ACID Deposited 1999-09-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T,F24L,N34D,I37M,K41N,K126R,A269T,A293V, N297S,S311G,I353T,S361F,S363G, V387L,M397L	PLP PYRIDOXAL-5'-PHOSPHATE × 2 GUA GLUTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PROTEIN WAS CRYSTALLIZED FROM 1.7M AMMONIUM SULFATE, 0.1 M SODIUM HEPES, 0.167 M GLUTARIC ACID, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.50 Å R-free 0.243
1CZE ASPARTATE AMINOTRANSFERASE MUTANT ATB17/139S/142N WITH SUCCINIC ACID Deposited 1999-09-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T,F24L,N34D,I37M,K41N,K126R,A269T,A293V, N297S,S311G,I353T,S361F,S363G, V387L,M397L	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SIN SUCCINIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；PROTEIN WAS CRYSTALLIZED FROM 1.7M AMMONIUM SULFATE, 0.1 M SODIUM HEPES, 0.167 M SUCCINIC ACID, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
1G4V ASPARTATE AMINOTRANSFERASE ACTIVE SITE MUTANT N194A/Y225F Deposited 2000-10-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：N194A, Y225F	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Sodium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 20.0K	Resolution 2.00 Å
1G4X ASPARTATE AMINOTRANSFERASE ACTIVE SITE MUTANT N194A/R292L Deposited 2000-10-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：N194A, R292L	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Sodium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å
1G7W ASPARTATE AMINOTRANSFERASE ACTIVE SITE MUTANT N194A/R386L Deposited 2000-11-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：N194A, R386L	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Sodium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å
1G7X ASPARTATE AMINOTRANSFERASE ACTIVE SITE MUTANT N194A/R292L/R386L Deposited 2000-11-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：N194A, R292L, R386L	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Sodium Sulfate , pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å
1IX6 Aspartate Aminotransferase Active Site Mutant V39F Deposited 2002-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：V39F	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.20 Å R-free 0.258
1IX7 Aspartate Aminotransferase Active Site Mutant V39F maleate complex Deposited 2002-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：V39F	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.247
1IX8 Aspartate Aminotransferase Active Site Mutant V39F/N194A Deposited 2002-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：V39F/N194A	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Ammonium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.259
1QIR ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191Y MUTATION, WITH BOUND MALEATE Deposited 1999-06-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Fragment：COMPLETE SUBUNIT	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN SOLUTION: 6MG/ML PROTEIN, 20 MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, 10 UM PLP, 5 MM EDTA, RESERVOIR SOLUTION: 20MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, AND 45-50% AMMONIUM SULFATE	Resolution 2.20 Å
1QIS ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191F MUTATION, WITH BOUND MALEATE Deposited 1999-06-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Fragment：COMPLETE SUBUNIT	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN SOLUTION: 13MG/ML PROTEIN, 20 MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, 10 UM PLP, 5 MM EDTA, RESERVOIR SOLUTION: 20MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, AND 45-50% AMMONIUM SULFATE	Resolution 1.90 Å
1QIT ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI, C191W MUTATION, WITH BOUND MALEATE Deposited 1999-06-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Fragment：COMPLETE SUBUNIT	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN SOLUTION: 9MG/ML PROTEIN, 20 MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, 10 UM PLP, 5 MM EDTA, RESERVOIR SOLUTION: 20MM POTASSIUM PHOSPHATE BUFFER, PH 7.5, AND 45-50% AMMONIUM SULFATE	Resolution 1.90 Å
1SPA ROLE OF ASP222 IN THE CATALYTIC MECHANISM OF ESCHERICHIA COLI ASPARTATE AMINOTRANSFERASE: THE AMINO ACID RESIDUE WHICH ENHANCES THE FUNCTION OF THE ENZYME-BOUND COENZYME PYRIDOXAL 5'-PHOSPHATE Deposited 1993-01-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	NPL N-METHYL-4-DEOXY-4-AMINO-PYRIDOXAL-5-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1TOE Unliganded structure of Hexamutant + A293D mutant of E. coli aspartate aminotransferase Deposited 2004-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：V39L,K41Y,T47I,N69L,T109S,A293D,N297S Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；potassium phosphate, PLP, EDTA, DTT, PEG 400, N-methylmorpholine, ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.00 Å R-free 0.202
1TOG Hydrocinnamic acid-bound structure of SRHEPT + A293D mutant of E. coli aspartate aminotransferase Deposited 2004-06-14	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Mutation：A12T,P13T,N34D,T109S,G261A,S285G,A293D,N297S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：A12T,P13T,N34D,T109S,G261A,S285G,A293D,N297S Non-standard monomer：Yes (specific site not provided by mmCIF)	HCI HYDROCINNAMIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；potassium phosphate, PLP, EDTA, DTT, PEG 400, N-methylmorpholine, ammonium sulfate, hydrocinnamic acid, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.31 Å R-free 0.232
1TOI Hydrocinnamic acid-bound structure of Hexamutant + A293D mutant of E. coli aspartate aminotransferase Deposited 2004-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：V39L,K41Y,T47I,N69L,T109S,A293D,N297S Non-standard monomer：Yes (specific site not provided by mmCIF)	HCI HYDROCINNAMIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；potassium phosphate, PLP, EDTA, DTT, PEG 400, N-methylmorpholine, ammonium sulfate, hydrocinnamic acid, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.90 Å R-free 0.197
1TOJ Hydrocinnamic acid-bound structure of SRHEPT mutant of E. coli aspartate aminotransferase Deposited 2004-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A12T,P13T,N34D,T109S,G261A,S285G,N297S Non-standard monomer：Yes (specific site not provided by mmCIF)	HCI HYDROCINNAMIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；potassium phosphate, PLP, EDTA, DTT, PEG 400, N-methylmorpholine, ammonium sulfate, hydrocinnamic acid, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 1.90 Å R-free 0.201
1X28 Crystal Structure of e.coli AspAT complexed with N-phosphopyridoxyl-L-glutamic acid Deposited 2005-04-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PGU N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；PEG 400, Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.243
1X29 Crystal Structure of e.coli AspAT complexed with N-phosphopyridoxyl-2-methyl-L-glutamic acid Deposited 2005-04-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PMG N-({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)-2-METHYL-L-GLUTAMIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；PEG 400, Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.232
1X2A Crystal Structure of e.coli AspAT complexed with N-phosphopyridoxyl-D-glutamic acid Deposited 2005-04-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain B 1–396（396 aa）	Not recorded	PDG N-({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)-D-GLUTAMIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；PEG 400, Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.234
1YOO ASPARTATE AMINOTRANSFERASE MUTANT ATB17 WITH ISOVALERIC ACID Deposited 1998-06-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, K126R, S139G, N142T, A269T, A293V, N297S, S311G, I353T, S361F, S363G, V387L, M397L	PLP PYRIDOXAL-5'-PHOSPHATE × 2 IVA ISOVALERIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.40 Å R-free 0.235
2AAT 2.8-ANGSTROMS-RESOLUTION CRYSTAL STRUCTURE OF AN ACTIVE-SITE MUTANT OF ASPARTATE AMINOTRANSFERASE FROM ESCHERICHIA COLI Deposited 1989-05-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：K246A	SO4 SULFATE ION × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
2D5Y Aspartate Aminotransferase Mutant MC With Isovaleric Acid Deposited 2005-11-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, A293V, N297S, I353T, S361F, S363G, V387L, M397L	PLP PYRIDOXAL-5'-PHOSPHATE × 2 IVA ISOVALERIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；35% Na2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.98 Å R-free 0.216
2D61 Aspartate Aminotransferase Mutant MA With Maleic Acid Deposited 2005-11-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, A293V, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；35% Na2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.01 Å R-free 0.221
2D63 Aspartate Aminotransferase Mutant MA With Isovaleric Acid Deposited 2005-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, A293V, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 IVA ISOVALERIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.216
2D64 Aspartate Aminotransferase Mutant MABC With Isovaleric Acid Deposited 2005-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, S139G, N142T, A293V, N297S, I353T, S361F, S363G, V387L, M397L	PLP PYRIDOXAL-5'-PHOSPHATE × 2 IVA ISOVALERIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.231
2D65 Aspartate Aminotransferase Mutant MABC Deposited 2005-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, S139G, N142T, A293V, N297S, I353T, S361F, S363G, V387L, M397L	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.202
2D66 Aspartate Aminotransferase Mutant MAB Deposited 2005-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, S139G, N142T, A293V, N297S	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.18 Å R-free 0.216
2D7Y Aspartate Aminotransferase Mutant MA Deposited 2005-11-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, A293V, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.66 Å R-free 0.215
2D7Z Aspartate Aminotransferase Mutant MAB Complexed with Maleic Acid Deposited 2005-11-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：A11T, F24L, N34D, I37M, K41N, S139G, N142T, A293V, N297S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；35% Na2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.65 Å R-free 0.219
2Q7W Structural Studies Reveals the Inactivation of E. coli L-aspartate aminotransferase (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via two mechanisms at pH 6.0 Deposited 2007-06-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2 PSZ 4-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)AMINO]THIOPHENE-2-CARBOXYLIC ACID × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GOL GLYCEROL × 22	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6；298 K；25 mM potassium phosphate, 43% saturated ammonium sulfate, 20 mM SADTA, pH 6.0, EVAPORATION, temperature 298K	Resolution 1.40 Å R-free 0.188
2QA3 Structural Studies Reveal the Inactivation of E. coli L-aspartate aminotransferase by (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via two mechanisms (at pH6.5) Deposited 2007-06-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 6 PSZ 4-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)AMINO]THIOPHENE-2-CARBOXYLIC ACID × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GOL GLYCEROL × 26	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；298 K；The well solutions contained 25 mM potassium phosphate and 43% saturated ammonium sulfate with 20 mM of SADTA at pH 6.5, EVAPORATION, temperature 298K	Resolution 1.75 Å R-free 0.197
2QB2 Structural Studies Reveal the Inactivation of E. coli L-aspartate aminotransferase by (s)-4,5-dihydro-2thiophenecarboylic acid (SADTA) via two mechanisms (at pH 7.0). Deposited 2007-06-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 4 PSZ 4-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)AMINO]THIOPHENE-2-CARBOXYLIC ACID × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GOL GLYCEROL × 24	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7；298 K；The well solutions contained 25 mM potassium phosphate and 43% saturated ammonium sulfate with 20 mM of SADTA at pH 7.0, EVAPORATION, temperature 298K	Resolution 1.70 Å R-free 0.184
2QB3 Structural Studies Reveal the Inactivation of E. coli L-Aspartate Aminotransferase by (s)-4,5-dihydro-2-thiophenecarboxylic acid (SADTA) via Two Mechanisms (at pH 7.5) Deposited 2007-06-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 4 PSZ 4-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)AMINO]THIOPHENE-2-CARBOXYLIC ACID × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GOL GLYCEROL × 14	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；298 K；The well solutions contained 25 mM potassium phosphate and 43% saturated ammonium sulfate with 20 mM of SADTA at pH 7.5, EVAPORATION, temperature 298K	Resolution 1.45 Å R-free 0.178
2QBT Structural Studies Reveal The Inactivation of E. coli L-aspartate aminotransferase by (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via Two Mechanisms (at pH 8.0) Deposited 2007-06-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 6 PSZ 4-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}METHYL)AMINO]THIOPHENE-2-CARBOXYLIC ACID × 2 PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 GOL GLYCEROL × 16	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 8；298 K；25 mM potassium phosphate, 43% saturated ammonium sulfate, 20 mM SADTA, pH 8.0, EVAPORATION, temperature 298K	Resolution 1.75 Å R-free 0.190
3AAT ACTIVITY AND STRUCTURE OF THE ACTIVE-SITE MUTANTS R386Y AND R386F OF ESCHERICHIA COLI ASPARTATE AMINOTRANSFERASE Deposited 1990-12-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：R374F	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
3QN6 Crystal Structures of Escherichia coli Aspartate Aminotransferase Reconstituted with 1-Deaza-Pyridoxal 5'-Phosphate: Internal Aldimine and Stable L-Aspartate External Aldimine Deposited 2011-02-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 10 EDO 1,2-ETHANEDIOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；2 L of protein (15-20 mg/ml, 50 mM TEA, pH 7.5, 100 mM KCL, 2 mM DTT, 10 M deaza-PLP) mixed with 2 L reservoir buffer (53-60% saturated ammonium sulfate and 50 mM TEA, pH 7.5), VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.79 Å R-free 0.188
3ZZJ Structure of an engineered aspartate aminotransferase Deposited 2011-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 4 BME BETA-MERCAPTOETHANOL × 2 GOL GLYCEROL × 10	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 2.50 Å R-free 0.262
3ZZK Structure of an engineered aspartate aminotransferase Deposited 2011-09-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：YES	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 8 GOL GLYCEROL × 10	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 1.78 Å R-free 0.199
4A00 Structure of an engineered aspartate aminotransferase Deposited 2011-09-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：YES	PP3 ALANYL-PYRIDOXAL-5'-PHOSPHATE × 2 PEG DI(HYDROXYETHYL)ETHER × 4 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 2.34 Å R-free 0.256
4DBC Substrate Activation in Aspartate Aminotransferase Deposited 2012-01-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Mutation：K258A	SO4 SULFATE ION × 8 EDO 1,2-ETHANEDIOL × 2 3QP (E)-N-{2-hydroxy-3-methyl-6-[(phosphonooxy)methyl]benzylidene}-L-aspartic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；2 uL of protein solution(15-20 mg/ml, 50 mM TEA, pH 7.5, 100 mM KCL, 2 mM DTT, 10 mM deaza-PLP, 50 mM L-aspartate) mixed with 2 uL reservoir buffer (53-60% saturated ammonium sulfate and 50 mM TEA), VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.50 Å R-free 0.194
4F5F Structure of Aspartate Aminotransferase Conversion to Tyrosine Aminotransferase: Chimera P1. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, A120G, S145A, V146I, F220I, A228G, V385I Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, A120G, S145A, V146I, F220I, A228G, V385I Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.25 Å R-free 0.213
4F5G Rational Design and Directed Evolution of E. coli Apartate Aminotransferase to Tyrosine Aminotransferase: Mutant P2. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, S283G, I351V Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, S283G, I351V Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.67 Å R-free 0.191
4F5H Intercoversion of Substrate Specificity: E. coli Aspatate Aminotransferase to Tyrosine Aminotransferase: Chimera P3. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, L56M, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, A228G, N295S, M331L Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, L56M, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, A228G, N295S, M331L Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.60 Å R-free 0.187
4F5I Substrate Specificity Conversion of E. coli Pyridoxal-5'-Phosphate Dependent Aspartate Aminotransferase to Tyrosine Aminotransferase: Chimera P4. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, L56M, N74T, T114S, S139T, S145A, V146I, F220I, F222I, A228G, Y254C, G259S, N295S, V385I Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, L56M, N74T, T114S, S139T, S145A, V146I, F220I, F222I, A228G, Y254C, G259S, N295S, V385I Non-standard monomer：Yes (specific site not provided by mmCIF)	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.212
4F5J Rational Design and Directed Evolution for Conversion of Substrate Specificity from E.coli Aspartate Aminotransferase to Tyrosine Aminotransferase: Mutant P5. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, F222I, A228G, Y254C Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, I43V, N74T, I78L, I81L, T114S, S145A, V146I, I197A, F220I, F222I, A228G, Y254C Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.204
4F5K Substrate Specificity Conversion of Aspartate Aminotransferase to Tyrosine Aminotransferase By The JANUS Algorithm: Chimera P6. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, I43V, L56M, N74T, I78L, I81L, T114S, S139T, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, G259S, S283G, V385I Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, I43V, L56M, N74T, I78L, I81L, T114S, S139T, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, G259S, S283G, V385I Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.227
4F5L A Theoretical Optimized Mutant for the Conversion of Substrate Specificity and Activity of Aspartate Aminotransferase to Tyrosine Aminotransferase: Chimera P7. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：I39V, N40D, I43V, L56M, N74T, I78L, I81L, T114S, S139T, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, N295S, V385I Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：I39V, N40D, I43V, L56M, N74T, I78L, I81L, T114S, S139T, S145A, V146I, I197A, F220I, F222I, A228G, Y254C, N295S, V385I Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.40 Å R-free 0.181
4F5M Wild-Type E. coli Aspartate Aminotransferase: A Template For The Interconversion of Substrate Specificity and Activity To Tyrosine Aminotransferase By The JANUS Algorithm. Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；277 K；8% PEG 4000, 0.1 M Sodium Acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.65 Å R-free 0.210
5EAA ASPARTATE AMINOTRANSFERASE FROM E. COLI, C191S MUTATION Deposited 1998-12-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Fragment：COMPLETE SUBUNIT	Mutation：YES	PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 2.40 Å
5T4L PLP and GABA Trigger GabR-Mediated Transcription Regulation in Bacillus subsidies via External Aldimine Formation Deposited 2016-08-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	77E (4R)-4-amino-6-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}hexanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25 mM Potassium phosphate 43% Ammonium sulfate	Resolution 1.53 Å R-free 0.166
5VWQ E.coli Aspartate aminotransferase-(1R,3S,4S)-3-amino-4-fluorocyclopentane-1-carboxylic acid (FCP) Deposited 2017-05-22	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa） Chain D 1–396（396 aa）	Not recorded	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25 mM potassium phosphate and 43% saturated ammonium sulfate	Resolution 1.80 Å R-free 0.192
5VWQ E.coli Aspartate aminotransferase-(1R,3S,4S)-3-amino-4-fluorocyclopentane-1-carboxylic acid (FCP) Deposited 2017-05-22	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–396（396 aa） Chain J 1–396（396 aa）	Not recorded	PMP 4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25 mM potassium phosphate and 43% saturated ammonium sulfate	Resolution 1.80 Å R-free 0.192
5VWR E.coli Aspartate aminotransferase-(1R,3S,4S)-3-amino-4-fluorocyclopentane-1-carboxylic acid (FCP)-alpha-ketoglutarate Deposited 2017-05-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–396（396 aa）	Not recorded	PL6 (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-glutamic acid × 2 GOL GLYCEROL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；25 mM potassium phosphate, 43% saturated ammonium sulfate	Resolution 1.72 Å R-free 0.190
8E9C Crystal structure of E. coli aspartate aminotransferase mutant AIFS in the ligand-free form at 100 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：V35A K37I T43F N64S Mutation：V35A K37I T43F N64S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Ammonium sulfate, HEPES, PEG-400, maleate	Resolution 2.18 Å R-free 0.224
8E9D Crystal structure of E. coli aspartate aminotransferase mutant AIFS bound to maleic acid at 100 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	MAE MALEIC ACID × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 400, maleate, ammonium sulfate, HEPES	Resolution 1.37 Å R-free 0.160
8E9J Crystal structure of E. coli aspartate aminotransferase mutant HEX in the ligand-free form at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：V35L, K37Y, T43I, N64L, T104S, N285S Mutation：V35L, K37Y, T43I, N64L, T104S, N285S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 2.09 Å R-free 0.198
8E9K Crystal structure of wild-type E. coli aspartate aminotransferase bound to maleate at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, maleate, PEG 400	Resolution 1.83 Å R-free 0.183
8E9L Crystal structure of E. coli aspartate aminotransferase mutant VFIT in the ligand-free form at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：K37F, T43I, N64T Mutation：K37F, T43I, N64T	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, maleate, PEG 400, ammonium sulfate	Resolution 2.31 Å R-free 0.222
8E9M Crystal structure of E. coli aspartate aminotransferase mutant VFIT bound to maleic acid at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, maleate, PEG 400	Resolution 1.76 Å R-free 0.175
8E9N Crystal structure of E. coli aspartate aminotransferase mutant VFIY in the ligand-free form at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：K37F, T43I, N64Y Mutation：K37F, T43I, N64Y	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, maleate, PEG 400	Resolution 1.88 Å R-free 0.178
8E9O Crystal structure of E. coli aspartate aminotransferase mutant VFIY bound to maleic acid at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 1.96 Å R-free 0.189
8E9P Crystal structure of wild-type E. coli aspartate aminotransferase in the ligand-free form at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 2.08 Å R-free 0.205
8E9Q Crystal structure of E. coli aspartate aminotransferase mutant HEX bound to maleic acid at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 1.80 Å R-free 0.172
8E9R Crystal structure of E. coli aspartate aminotransferase mutant VFCS in the ligand-free form at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：K37F, T43C, N64S Mutation：K37F, T43C, N64S	SO4 SULFATE ION × 2 PLP PYRIDOXAL-5'-PHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, maleate, ammonium sulfate, PEG 400	Resolution 1.90 Å R-free 0.191
8E9S Crystal structure of E. coli aspartate aminotransferase mutant VFCS bound to maleic acid at 278 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 MAE MALEIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 2.00 Å R-free 0.185
8E9T Crystal structure of wild-type E. coli aspartate aminotransferase in the ligand-free form at 303 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 2.13 Å R-free 0.200
8E9U Crystal structure of E. coli aspartate aminotransferase mutant HEX in the ligand-free form at 303 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Mutation：V35L, K37Y, T43I, N64L, T104S, N285S Mutation：V35L, K37Y, T43I, N64L, T104S, N285S	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 1.94 Å R-free 0.178
8E9V Crystal structure of E. coli aspartate aminotransferase mutant VFIT in the ligand-free form at 303 K Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–396（395 aa） Chain B 2–396（395 aa）	Not recorded	PLP PYRIDOXAL-5'-PHOSPHATE × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；HEPES, ammonium sulfate, PEG 400, maleate	Resolution 2.01 Å R-free 0.196

103 other PDB entries and 104 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AAT_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–388； UniProt 1–396 Author chain B； PDBConstruct 1–388； UniProt 1–396

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1tok
Deposition date deposition_date	2004-06-14
Structure title title	Maleic acid-bound structure of SRHEPT mutant of E. coli aspartate aminotransferase
Keywords keywords	aspartate aminotransferase hexamutant, SRHEPT, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.22 Å
Radius of gyration Rg (electron density) rg_electron	27.25 Å
Forward intensity I(0) i0	126452000.00
Molecular weight molecular_weight	87777.0 kDa
Excluded volume excluded_volume	109350 Å³
Envelope volume envelope_volume	127900 Å³
Hydration-shell volume shell_volume	38117 Å³
Envelope diameter envelope_diameter	98.6 Å
Shell Rg shell_rg	35.41 Å
Envelope Rg envelope_rg	27.48 Å
Shape Rg shape_rg	27.25 Å
Total Rg total_rg	28.03 Å
Total atoms total_atoms	6180
Residues n_residues	790
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	95.7 Å
Rg (real space) rg_real	28.15 Å
Rg uncertainty (real space) rg_real_error	0.73 Å
I(0) (real space) i0_real	1.2650e+08
I(0) uncertainty (real space) i0_real_error	1.8790e+06
Rg (reciprocal space) rg_reciprocal	28.17 Å
I(0) (reciprocal space) i0_reciprocal	126500000.0000
Solution quality estimate total_estimate	0.7000
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.2 Å
Skewness Skewness skewness	0.326
Kurtosis Kurtosis kurtosis	-0.261
Angular range angular_range	— – 0.2800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	53320000.0000
Real-space data points n_real_points	57
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.798; Stabil: 1.000; Sysdev: 0.242; Positv: 1.000; Valcen: 0.995; Smooth: 0.981

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Aspartate aminotransferase
Molecular weight formula_weight	43825.3 kDa
EC 编号 ec_number	2.6.1.1
Mutation mutation	A12T,P13T,N34D,T109S,G261A,S285G,N297S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6463

MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MALEIC ACID
Molecular weight formula_weight	116.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	283

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1toka_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.67 — PLP-dependent transferase-like
Superfamily Superfamily superfamily	c.67.1 — PLP-dependent transferases
Family Family family	c.67.1.1 — AAT-like

Domain ID domain_id	d1tokb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.67 — PLP-dependent transferase-like
Superfamily Superfamily superfamily	c.67.1 — PLP-dependent transferases
Family Family family	c.67.1.1 — AAT-like

CATH v4.4 (4 domains)

Domain ID domain_id	1tokA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	10 — Aspartate Aminotransferase, domain 1

Domain ID domain_id	1tokA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	640 — Aspartate Aminotransferase; domain 2
Homologous superfamily homologous superfamily	10 — Type I PLP-dependent aspartate aminotransferase-like (Major domain)

Domain ID domain_id	1tokB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	10 — Aspartate Aminotransferase, domain 1

Domain ID domain_id	1tokB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	640 — Aspartate Aminotransferase; domain 2
Homologous superfamily homologous superfamily	10 — Type I PLP-dependent aspartate aminotransferase-like (Major domain)

▶

8. Citations (1)

▶

Unit-cell length a length_a	140.142 Å
Unit-cell length b length_b	140.142 Å
Unit-cell length c length_c	81.075 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 63
Space-group number int_tables_number	173
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1957
R_work r_work	0.1941
R_free r_free	0.2267

fit	/app/data/saxs_computation/to/1tok/1tok.fit
pddf	/app/data/pr_computation/to/1tok/1tok.pr.out
profile	/app/data/saxs_computation/to/1tok/1tok.dat