SAXSdb — 1uuj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT

MUS MUSCULUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 ACETATE ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 BENZOIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LIS1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–88； UniProt 1–85 Author chain B； PDBConstruct 4–88； UniProt 1–85 Author chain C； PDBConstruct 4–88； UniProt 1–85 Author chain D； PDBConstruct 4–88； UniProt 1–85

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1uuj
Deposition date deposition_date	2003-12-22
Structure title title	N-terminal domain of Lissencephaly-1 protein (Lis-1)
Keywords keywords	PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE, MITOSIS, NEUROGENESIS, CYTOSKELETON, CELL DIVISION, MICROTUBULE; CELL DIVISION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1uuj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1uuj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1uuj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.44 Å
Rg (electron density)	17.47 Å
Total Rg	18.38 Å
Atom count	1260
Residues	146
Excluded volume	22447 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1uuj__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1uuj__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT
Molecular weight formula_weight	10272.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2772

GAMVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLG

Source Source

Source organism organism	MUS MUSCULUS
Common name common_name	MOUSE
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	BENZOIC ACID
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	181

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1uuja_
Class class	a — All alpha proteins
Fold Fold fold	a.221 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Superfamily Superfamily superfamily	a.221.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Family Family family	a.221.1.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain

Domain ID domain_id	d1uujb_
Class class	a — All alpha proteins
Fold Fold fold	a.221 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Superfamily Superfamily superfamily	a.221.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Family Family family	a.221.1.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain

Domain ID domain_id	d1uujc_
Class class	a — All alpha proteins
Fold Fold fold	a.221 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Superfamily Superfamily superfamily	a.221.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Family Family family	a.221.1.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain

Domain ID domain_id	d1uujd_
Class class	a — All alpha proteins
Fold Fold fold	a.221 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Superfamily Superfamily superfamily	a.221.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain
Family Family family	a.221.1.1 — Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain

CATH v4.4 (4 domains)

Domain ID domain_id	1uujA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	960 — Mitochondrial Import Receptor Subunit Tom20; Chain A
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1uujB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	960 — Mitochondrial Import Receptor Subunit Tom20; Chain A
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1uujC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	960 — Mitochondrial Import Receptor Subunit Tom20; Chain A
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1uujD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	960 — Mitochondrial Import Receptor Subunit Tom20; Chain A
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	62.988 Å
Unit-cell length b length_b	111.753 Å
Unit-cell length c length_c	47.397 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.1920
R_work r_work	0.1900
R_free r_free	0.2460

N-terminal domain of Lissencephaly-1 protein (Lis-1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1uuj__assembly_1__model_1

1uuj__assembly_1__model_1 | I(q)

1uuj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

N-terminal domain of Lissencephaly-1 protein (Lis-1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1uuj__assembly_1__model_1

1uuj__assembly_1__model_1 | I(q)

1uuj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)