SAXSdb — 1v30

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical UPF0131 protein PH0828

Pyrococcus horikoshii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y828_PYRHO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–116； UniProt 1–116

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1v30
Deposition date deposition_date	2003-10-21
Structure title title	Crystal Structure Of Uncharacterized Protein PH0828 From Pyrococcus horikoshii
Keywords keywords	ALPHA+BETA, STRUCTURAL GENOMICS, UNKNOWN FUNCTION; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1v30__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1v30__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1v30__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.67 Å
Rg (electron density)	14.08 Å
Total Rg	15.34 Å
Atom count	1008
Residues	118
Excluded volume	18043 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1v30__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Hypothetical UPF0131 protein PH0828
Molecular weight formula_weight	14764.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1189

MSYKEKSVRIAVYGTLRKGKPLHWYLKGAKFLGEDWIEGYQLYFEYLPYAVKGKGKLKVEVYEVDKETFERINEIEIGTGYRLVEVSTKFGKAFLWEWGSKPRGKRIKSGDFDEIRLEHHHHHH

Source Source

Source organism organism	Pyrococcus horikoshii
NCBI taxonomy ID ncbi_taxonomy_id	53953
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID
Molecular weight formula_weight	207.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	181

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1v30a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.269 — Gamma-glutamyl cyclotransferase-like
Superfamily Superfamily superfamily	d.269.1 — Gamma-glutamyl cyclotransferase-like
Family Family family	d.269.1.1 — Gamma-glutamyl cyclotransferase-like

Domain ID domain_id	d1v30a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	1v30A00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	490 — Hypothetical upf0131 protein ytfp
Homologous superfamily homologous superfamily	10 — Gamma-glutamyl cyclotransferase-like

▶

Unit-cell length a length_a	51.692 Å
Unit-cell length b length_b	51.692 Å
Unit-cell length c length_c	81.511 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.400 Å
Low-resolution limit resolution_low	7.000 Å
R factor r_factor	0.2170
R_work r_work	0.2170
R_free r_free	0.2290

Crystal Structure Of Uncharacterized Protein PH0828 From Pyrococcus horikoshii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical UPF0131 protein PH0828

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1v30__assembly_1__model_1

1v30__assembly_1__model_1 | I(q)

1v30__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal Structure Of Uncharacterized Protein PH0828 From Pyrococcus horikoshii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical UPF0131 protein PH0828

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1v30__assembly_1__model_1

1v30__assembly_1__model_1 | I(q)

1v30__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)