SAXSdb — 1vf6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PALS1-associated tight junction protein

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q9JLB2） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MAGUK p55 subfamily member 5 × 1 （Q9JLB2） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	MAGUK p55 subfamily member 5 × 4 （Q9JLB2） water × 8	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	MAGUK p55 subfamily member 5 × 2 （Q9JLB2） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INADL_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–60； UniProt 9–67 Author chain B； PDBConstruct 2–60； UniProt 9–67

MAGUK p55 subfamily member 5

Mus musculus

UniProt Q9JLB2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	PALS1-associated tight junction protein × 1 （Q8NI35） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	PALS1-associated tight junction protein × 1 （Q8NI35） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	PALS1-associated tight junction protein × 4 （Q8NI35） water × 8	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	PALS1-associated tight junction protein × 2 （Q8NI35） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPP5_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 15–72； UniProt 123–180 Author chain D； PDBConstruct 15–72； UniProt 123–180

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1vf6
Deposition date deposition_date	2004-04-09
Structure title title	2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex
Keywords keywords	;L27 domain, heterodimer, four-helical bundle, coiled-coil, hydrophobic packing interactions, PROTEIN BINDING-PROTEIN TRANSPORT COMPLEX ;; PROTEIN BINDING/PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1vf6__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1vf6__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1vf6__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.06 Å
Rg (electron density)	29.13 Å
Total Rg	29.74 Å
Atom count	3546
Residues	434
Excluded volume	63547 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1vf6__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1vf6__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1vf6__assembly_3__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1vf6__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PALS1-associated tight junction protein
Molecular weight formula_weight	9537.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1867

MKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILESGKETAAAKFERQHMDSSTSA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	MAGUK p55 subfamily member 5
Molecular weight formula_weight	8245.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MGSSHHHHHHSQDPDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMSKASPPF

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	94

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d1vf6a_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1vf6b_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1vf6c1
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1vf6c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1vf6d_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

CATH v4.4 (4 domains)

Domain ID domain_id	1vf6A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1vf6B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1vf6C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1vf6D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

▶

Unit-cell length a length_a	111.060 Å
Unit-cell length b length_b	111.060 Å
Unit-cell length c length_c	193.690 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2420
R_work r_work	0.2420
R_free r_free	0.2620

2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

PALS1-associated tight junction protein

State in the Current Structure

Other States of the Same Protein in the Database

MAGUK p55 subfamily member 5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vf6__assembly_3__model_1

1vf6__assembly_3__model_1 | I(q)

1vf6__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)

2.1 Angstrom crystal structure of the PALS-1-L27N and PATJ L27 heterodimer complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

PALS1-associated tight junction protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MAGUK p55 subfamily member 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vf6__assembly_3__model_1

1vf6__assembly_3__model_1 | I(q)

1vf6__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)