1vrq

Crystal Structure of Heterotetrameric Sarcosine Oxidase from Corynebacterium sp. U-96 in complex with Folinic Acid

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sarcosine oxidase alpha subunit

Corynebacterium sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sarcosine oxidase beta subunit × 1 （Q50LF2） Sarcosine oxidase gamma subunit × 1 （Q50LE9） Sarcosine oxidase delta subunit × 1 （Q50LF1） SULFATE ION × 13 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 1 FLAVIN-ADENINE DINUCLEOTIDE × 1 FLAVIN MONONUCLEOTIDE × 1 N,N-DIMETHYLGLYCINE × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase gamma subunit × 2 （Q50LE9） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase gamma subunit × 2 （Q50LE9） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q50LF0_9CORY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–964； UniProt 2–965

Sarcosine oxidase beta subunit

Corynebacterium sp.

UniProt Q50LF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sarcosine oxidase alpha subunit × 1 （Q50LF0） Sarcosine oxidase gamma subunit × 1 （Q50LE9） Sarcosine oxidase delta subunit × 1 （Q50LF1） SULFATE ION × 13 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 1 FLAVIN-ADENINE DINUCLEOTIDE × 1 FLAVIN MONONUCLEOTIDE × 1 N,N-DIMETHYLGLYCINE × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase gamma subunit × 2 （Q50LE9） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase gamma subunit × 2 （Q50LE9） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q50LF2_9CORY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–404； UniProt 2–405

Sarcosine oxidase gamma subunit

Corynebacterium sp.

UniProt Q50LE9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sarcosine oxidase alpha subunit × 1 （Q50LF0） Sarcosine oxidase beta subunit × 1 （Q50LF2） Sarcosine oxidase delta subunit × 1 （Q50LF1） SULFATE ION × 13 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 1 FLAVIN-ADENINE DINUCLEOTIDE × 1 FLAVIN MONONUCLEOTIDE × 1 N,N-DIMETHYLGLYCINE × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase delta subunit × 2 （Q50LF1） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q50LE9_9CORY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–200； UniProt 6–205

Sarcosine oxidase delta subunit

Corynebacterium sp.

UniProt Q50LF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sarcosine oxidase alpha subunit × 1 （Q50LF0） Sarcosine oxidase beta subunit × 1 （Q50LF2） Sarcosine oxidase gamma subunit × 1 （Q50LE9） SULFATE ION × 13 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 1 FLAVIN-ADENINE DINUCLEOTIDE × 1 FLAVIN MONONUCLEOTIDE × 1 N,N-DIMETHYLGLYCINE × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase gamma subunit × 2 （Q50LE9） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 8	Sarcosine oxidase alpha subunit × 2 （Q50LF0） Sarcosine oxidase beta subunit × 2 （Q50LF2） Sarcosine oxidase gamma subunit × 2 （Q50LE9） SULFATE ION × 26 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 2 N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid × 2 FLAVIN-ADENINE DINUCLEOTIDE × 2 FLAVIN MONONUCLEOTIDE × 2 N,N-DIMETHYLGLYCINE × 2 ZINC ION × 2 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q50LF1_9CORY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–99； UniProt 1–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1vrq
Deposition date deposition_date	2005-04-27
Structure title title	Crystal Structure of Heterotetrameric Sarcosine Oxidase from Corynebacterium sp. U-96 in complex with Folinic Acid
Keywords keywords	Heterotetrameric sarcosine oxidase, flavoenzyme, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1vrq__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1vrq__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1vrq__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.27 Å
Rg (electron density)	52.57 Å
Total Rg	52.62 Å
Atom count	25478
Residues	3302
Excluded volume	448160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1vrq__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1vrq__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1vrq__assembly_3__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Sarcosine oxidase alpha subunit
Molecular weight formula_weight	102850.3 kDa
EC 编号 ec_number	1.5.3.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	13880

SKPQRLSAAQTAGARINRDEALTLTVDGQQLSAFRGDTVASAMLANGLRSCGNSMYLDRPRGIFSAGVEEPNALITVGARHQADINESMLPATTVSVTDGLNATLLSGLGVLDPSEDPAYYDHVHVHTDVLVVGAGPAGLAAAREASRSGARVMLLDERPEAGGTLREASGEQIDGIDAAQWIDAVTEELAAAEETTHLQRTTVFGSYDANYILAAQRRTVHLDGPSGQGVSRERIWHIRAKQVVLATAAHERPIVFENNDRPGIMLAGSVRSYLNRFGVRAGSKIAVATTNDSVYPLVSELAASGGVVAVIDARQNISAAAAQAVTDGVTVLTGSVVANTEADASGELSAVLVATLDEQRNLGEAQRFEADVLAVSGGFNPVVHLHSQRQGKLNWDTSIHAFVPADAVANQHLAGALTGLLDTASALSTGAATGAAAASAAGFEKIAEVPQALAVPAGETRPVWLVPSLSGDDAVHYKFHFVDLQRDQTVADVLRATGAGMQSVEHIKRYTSISTANDQGKTSGVAAIGVIAAVLGIENPAQIGTTTFRAPYTPVSFAALAGRTRGELLDPARLTAMHPWHLAHGAKFEDVGQWKRPWYYPQDGESMDEAVYRECKAVRDSVGMLDASTLGKIEIRGKDAAEFLNRMYTNGYTKLKVGMGRYGVMCKADGMIFDDGVTLRLAEDRFLMHTTTGGAADVLDWLEEWLQTEWPELDVTCTSVTEQLATVAVVGPRSRDVIAKLASSLDVSNDAFKFMAFQDVTLDSGIEARISRISFSGELAFEIAIPAWHGLQVWEDVYAAGQEFNITPYGTETMHVLRAEKGFIIVGQDTDGTVTPQDAGMEWVVSKLKDFVGKRSFSREDNVREDRKHLVSVLPVDSSLRLAEGAALVAADAVASEGVTPMEGWVTHAYNSPALGRTFGLALIKNGRNRIGEVLKTPVDGQLVDVQVSDLVLFDPEGSRRDG

Source Source

Source organism organism	Corynebacterium sp.
NCBI taxonomy ID ncbi_taxonomy_id	31944
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Sarcosine oxidase beta subunit
Molecular weight formula_weight	44048.7 kDa
EC 编号 ec_number	1.5.3.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ADLLPEHPEFLWNNPEPKKSYDVVIVGGGGHGLATAYYLAKNHGITNVAVLEKGWLAGGNMARNTTIIRSNYLWDESAGIYEKSLKLWEELPEELEYDFLFSQRGVLNLAHTLGDVRESIRRVEANKFNGVDAEWLTPEQVKEVCPIINTGDNIRYPVMGATYQPRAGIAKHDHVAWAFARKANEMGVDIIQNCEVTGFLKDGEKVTGVKTTRGTILAGKVALAGAGHSSVLAELAGFELPIQSHPLQALVSELFEPVHPTVVMSNHIHVYVSQAHKGELVMGAGIDSYNGYGQRGAFHVIEEQMAAAVELFPIFARAHVLRTWGGIVDTTMDASPIISKTPIQNLYVNCGWGTGGFKGTPGAGYTLAHTIAHDEPHKLNAPFALERFETGHLIDEHGAAAVAH

Source Source

Source organism organism	Corynebacterium sp.
NCBI taxonomy ID ncbi_taxonomy_id	31944
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Sarcosine oxidase gamma subunit
Molecular weight formula_weight	21732.5 kDa
EC 编号 ec_number	1.5.3.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MIDSTQLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVAHHHHHH

Source Source

Source organism organism	Corynebacterium sp.
NCBI taxonomy ID ncbi_taxonomy_id	31944
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Sarcosine oxidase delta subunit
Molecular weight formula_weight	11445.8 kDa
EC 编号 ec_number	1.5.3.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MMLIECPNCGPRNENEFKYGGEAHVAYPEDPNALSDKEWSRYLFYRGNKKGIFAERWVHSGGCRKWFNALRDTVSYEFKAVYRAGEARPQLDSTEGGTR

Source Source

Source organism organism	Corynebacterium sp.
NCBI taxonomy ID ncbi_taxonomy_id	31944
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 6 Entity 6 non-polymer

Description description	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
Molecular weight formula_weight	663.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid
Molecular weight formula_weight	473.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	N,N-DIMETHYLGLYCINE
Molecular weight formula_weight	103.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1141

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	1vrqA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	120 — Probable tRNA modification gtpase trme; domain 1

Domain ID domain_id	1vrqB01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	50 — FAD/NAD(P)-binding domain
Homologous superfamily homologous superfamily	60 — FAD/NAD(P)-binding domain

Domain ID domain_id	1vrqB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	9 — D-Amino Acid Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — D-Amino Acid Oxidase, subunit A, domain 2

Domain ID domain_id	1vrqC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	120 — Probable tRNA modification gtpase trme; domain 1

Domain ID domain_id	1vrqC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1520 — Heterotetrameric sarcosine oxidase

Domain ID domain_id	1vrqD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2270 — Folate-binding fold
Homologous superfamily homologous superfamily	10 — Folate-binding superfamily

▶

Unit-cell length a length_a	199.402 Å
Unit-cell length b length_b	199.402 Å
Unit-cell length c length_c	197.309 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	99.500 Å
R factor r_factor	0.1920
R_work r_work	0.1920
R_free r_free	0.2241

Crystal Structure of Heterotetrameric Sarcosine Oxidase from Corynebacterium sp. U-96 in complex with Folinic Acid

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sarcosine oxidase alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sarcosine oxidase beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sarcosine oxidase gamma subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sarcosine oxidase delta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vrq__assembly_3__model_1

1vrq__assembly_3__model_1 | I(q)

1vrq__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)