SAXSdb — 1vzy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

33 KDA CHAPERONIN

Bacillus subtilis 168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	ZINC ION × 4 ACETATE ION × 12 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HSLO_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–291； UniProt 1–291 Author chain B； PDBConstruct 1–291； UniProt 1–291

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1vzy
Deposition date deposition_date	2004-05-29
Structure title title	Crystal structure of the Bacillus subtilis HSP33
Keywords keywords	;CHAPERONE, HEAT SHOCK PROTEIN, CRYSTAL ENGINEERING, MOLECULAR CHAPERONE, REDOX-ACTIVE CENTER, PSI, PROTEIN STRUCTURE INITIATIVE, MCSG, MIDWEST CENTER FOR STRUCTURAL GENOMICS ;; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1vzy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1vzy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1vzy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.05 Å
Rg (electron density)	32.03 Å
Total Rg	32.71 Å
Atom count	8816
Residues	1152
Excluded volume	157290 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1vzy__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	33 KDA CHAPERONIN
Molecular weight formula_weight	31731.1 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4685

MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDDKLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNAAGKLDVRRAVGTNGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR

Source Source

Source organism organism	Bacillus subtilis 168
NCBI taxonomy ID ncbi_taxonomy_id	224308
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	277

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1vzya1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.193 — Hsp33 domain
Superfamily Superfamily superfamily	d.193.1 — Hsp33 domain
Family Family family	d.193.1.1 — Hsp33 domain

Domain ID domain_id	d1vzya2
Class class	g — Small proteins
Fold Fold fold	g.81 — HSP33 redox switch-like
Superfamily Superfamily superfamily	g.81.1 — HSP33 redox switch-like
Family Family family	g.81.1.1 — HSP33 redox switch-like

Domain ID domain_id	d1vzyb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.193 — Hsp33 domain
Superfamily Superfamily superfamily	d.193.1 — Hsp33 domain
Family Family family	d.193.1.1 — Hsp33 domain

Domain ID domain_id	d1vzyb2
Class class	g — Small proteins
Fold Fold fold	g.81 — HSP33 redox switch-like
Superfamily Superfamily superfamily	g.81.1 — HSP33 redox switch-like
Family Family family	g.81.1.1 — HSP33 redox switch-like

CATH v4.4 (4 domains)

Domain ID domain_id	1vzyA01
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	30 — Hsp33 domain
Homologous superfamily homologous superfamily	10 — Hsp33 domain

Domain ID domain_id	1vzyA02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1280 — CBS domain Like
Homologous superfamily homologous superfamily	10 — HSP33 redox switch-like

Domain ID domain_id	1vzyB01
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	30 — Hsp33 domain
Homologous superfamily homologous superfamily	10 — Hsp33 domain

Domain ID domain_id	1vzyB02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1280 — CBS domain Like
Homologous superfamily homologous superfamily	10 — HSP33 redox switch-like

▶

Unit-cell length a length_a	115.292 Å
Unit-cell length b length_b	115.292 Å
Unit-cell length c length_c	106.441 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.970 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.1970
R_free r_free	0.2250

Crystal structure of the Bacillus subtilis HSP33

1. Protein Identity and Related Structures Protein Identity & Related Structures

33 KDA CHAPERONIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vzy__assembly_1__model_1

1vzy__assembly_1__model_1 | I(q)

1vzy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the Bacillus subtilis HSP33

1. Protein Identity and Related Structures Protein Identity & Related Structures

33 KDA CHAPERONIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vzy__assembly_1__model_1

1vzy__assembly_1__model_1 | I(q)

1vzy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)