1wap

TRP RNA-BINDING ATTENUATION PROTEIN IN COMPLEX WITH L-TRYPTOPHAN

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN

Bacillus subtilis

UniProt P19466

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 11	TRYPTOPHAN × 11 water × 11	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 11	TRYPTOPHAN × 11 water × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRB_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–75； UniProt 1–75 Author chain B； PDBConstruct 1–75； UniProt 1–75 Author chain C； PDBConstruct 1–75； UniProt 1–75 Author chain D； PDBConstruct 1–75； UniProt 1–75 Author chain E； PDBConstruct 1–75； UniProt 1–75 Author chain F； PDBConstruct 1–75； UniProt 1–75 Author chain G； PDBConstruct 1–75； UniProt 1–75 Author chain H； PDBConstruct 1–75； UniProt 1–75 Author chain I； PDBConstruct 1–75； UniProt 1–75 Author chain J； PDBConstruct 1–75； UniProt 1–75 Author chain K； PDBConstruct 1–75； UniProt 1–75 Author chain L； PDBConstruct 1–75； UniProt 1–75 Author chain M； PDBConstruct 1–75； UniProt 1–75 Author chain N； PDBConstruct 1–75； UniProt 1–75 Author chain O； PDBConstruct 1–75； UniProt 1–75 Author chain P； PDBConstruct 1–75； UniProt 1–75 Author chain Q； PDBConstruct 1–75； UniProt 1–75 Author chain R； PDBConstruct 1–75； UniProt 1–75 Author chain S； PDBConstruct 1–75； UniProt 1–75 Author chain T； PDBConstruct 1–75； UniProt 1–75 Author chain U； PDBConstruct 1–75； UniProt 1–75 Author chain V； PDBConstruct 1–75； UniProt 1–75

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wap
Deposition date deposition_date	1995-02-03
Structure title title	TRP RNA-BINDING ATTENUATION PROTEIN IN COMPLEX WITH L-TRYPTOPHAN
Keywords keywords	TRP OPERON, BACILLUS SUBTILIS, RNA-BINDING ATTENUATION PROTEIN; RNA-BINDING ATTENUATION PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1wap__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1wap__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1wap__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.18 Å
Rg (electron density)	29.92 Å
Total Rg	30.93 Å
Atom count	5904
Residues	740
Excluded volume	105420 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1wap__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1wap__assembly_2__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	TRP RNA-BINDING ATTENUATION PROTEIN
Molecular weight formula_weight	8343.5 kDa
Source method src_method	man
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V
Atom count atom_count	13834

MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	TRYPTOPHAN
Molecular weight formula_weight	204.2 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2026

▼

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

Domain ID domain_id	d1wapa_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapb_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapc_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapd_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wape_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapf_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapg_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1waph_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapi_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapj_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapk_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapl_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapm_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapn_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapo_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapp_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapq_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapr_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1waps_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapt_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapu_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

Domain ID domain_id	d1wapv_
Class class	b — All beta proteins
Fold Fold fold	b.82 — Double-stranded beta-helix
Superfamily Superfamily superfamily	b.82.5 — TRAP-like
Family Family family	b.82.5.1 — Trp RNA-binding attenuation protein (TRAP)

CATH v4.4 (22 domains)

Domain ID domain_id	1wapA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapM00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapN00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapO00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapP00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapQ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapR00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

Domain ID domain_id	1wapV00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	50 — TRAP-like

▶

Unit-cell length a length_a	155.910 Å
Unit-cell length b length_b	114.440 Å
Unit-cell length c length_c	105.670 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.64 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	88

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.1780
R_work r_work	0.1780
R_free r_free	0.2250

TRP RNA-BINDING ATTENUATION PROTEIN IN COMPLEX WITH L-TRYPTOPHAN

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wap__assembly_2__model_1

1wap__assembly_2__model_1 | I(q)

1wap__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

CATH v4.4 (22 domains)

7. Citations (2)

TRP RNA-BINDING ATTENUATION PROTEIN IN COMPLEX WITH L-TRYPTOPHAN

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRP RNA-BINDING ATTENUATION PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wap__assembly_2__model_1

1wap__assembly_2__model_1 | I(q)

1wap__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 44 domains

SCOP 2.08 (22 domains)

CATH v4.4 (22 domains)

7. Citations (2)