1wpl

Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase I

Rattus norvegicus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase I feedback regulatory protein × 10 （P70552） ZINC ION × 10 7,8-DIHYDROBIOPTERIN × 10 TRIPHOSPHATE × 10 SODIUM ION × 10 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GCH1_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–230； UniProt 12–241 Author chain B； PDBConstruct 1–230； UniProt 12–241 Author chain C； PDBConstruct 1–230； UniProt 12–241 Author chain D； PDBConstruct 1–230； UniProt 12–241 Author chain E； PDBConstruct 1–230； UniProt 12–241 Author chain F； PDBConstruct 1–230； UniProt 12–241 Author chain G； PDBConstruct 1–230； UniProt 12–241 Author chain H； PDBConstruct 1–230； UniProt 12–241 Author chain I； PDBConstruct 1–230； UniProt 12–241 Author chain J； PDBConstruct 1–230； UniProt 12–241

GTP cyclohydrolase I feedback regulatory protein

Rattus norvegicus

UniProt P70552

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase I × 10 （P22288） ZINC ION × 10 7,8-DIHYDROBIOPTERIN × 10 TRIPHOSPHATE × 10 SODIUM ION × 10 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFRP_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–84； UniProt 0–83 Author chain L； PDBConstruct 1–84； UniProt 0–83 Author chain M； PDBConstruct 1–84； UniProt 0–83 Author chain N； PDBConstruct 1–84； UniProt 0–83 Author chain O； PDBConstruct 1–84； UniProt 0–83 Author chain P； PDBConstruct 1–84； UniProt 0–83 Author chain Q； PDBConstruct 1–84； UniProt 0–83 Author chain R； PDBConstruct 1–84； UniProt 0–83 Author chain S； PDBConstruct 1–84； UniProt 0–83 Author chain T； PDBConstruct 1–84； UniProt 0–83

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wpl
Deposition date deposition_date	2004-09-08
Structure title title	Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
Keywords keywords	ENZYME-REGULATORY PROTEIN COMPLEX, HYDROLASE-PROTEIN BINDING COMPLEX; HYDROLASE/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1wpl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1wpl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1wpl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.33 Å
Rg (electron density)	41.72 Å
Total Rg	41.93 Å
Atom count	22420
Residues	2780
Excluded volume	400070 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1wpl__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	GTP cyclohydrolase I
Molecular weight formula_weight	25819.7 kDa
EC 编号 ec_number	3.5.4.16
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J
Atom count atom_count	22650

GFPERELPRPGASRPAEKSRPPEAKGAQPADAWKAGRPRSEEDNELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

Source Source

Source organism organism	Rattus norvegicus
Common name common_name	Norway rat
NCBI taxonomy ID ncbi_taxonomy_id	10116
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GTP cyclohydrolase I feedback regulatory protein
Molecular weight formula_weight	9683.2 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P,Q,R,S,T

MPYLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVNDPPRIVLDKLECRGFRVLSMTGVGQTLVWCLHKE

Source Source

Source organism organism	Rattus norvegicus
Common name common_name	Norway rat
NCBI taxonomy ID ncbi_taxonomy_id	10116
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 non-polymer

Description description	7,8-DIHYDROBIOPTERIN
Molecular weight formula_weight	239.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 5 Entity 5 non-polymer

Description description	TRIPHOSPHATE
Molecular weight formula_weight	258.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 6 Entity 6 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	230

▼

6. Fold Classification (SCOP + CATH) 50 domains

SCOP 2.08 (20 domains)

Domain ID domain_id	d1wpla_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wpld_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wple_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wpli_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplj_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d1wplk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wpll_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplm_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wpln_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplo_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplq_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplr_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wpls_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d1wplt_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

CATH v4.4 (30 domains)

Domain ID domain_id	1wplA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplF01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplG01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplH01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplI01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplJ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	286 — GTP Cyclohydrolase I; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, N-terminal domain

Domain ID domain_id	1wplJ02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1130 — GTP Cyclohydrolase I, domain 2
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain

Domain ID domain_id	1wplK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplN00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplO00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplP00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplQ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplR00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplS00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

Domain ID domain_id	1wplT00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1410 — Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K
Homologous superfamily homologous superfamily	10 — GTP cyclohydrolase I feedback regulatory protein GFRP

▶

Unit-cell length a length_a	121.720 Å
Unit-cell length b length_b	109.670 Å
Unit-cell length c length_c	130.270 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.85 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	20

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	—
R_work r_work	0.2069
R_free r_free	0.2328

Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase I

State in the Current Structure

Other States of the Same Protein in the Database

GTP cyclohydrolase I feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wpl__assembly_1__model_1

1wpl__assembly_1__model_1 | I(q)

1wpl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 50 domains

SCOP 2.08 (20 domains)

CATH v4.4 (30 domains)

7. Citations (1)

Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GTP cyclohydrolase I feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wpl__assembly_1__model_1

1wpl__assembly_1__model_1 | I(q)

1wpl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 50 domains

SCOP 2.08 (20 domains)

CATH v4.4 (30 domains)

7. Citations (1)