SAXSdb — 1x99

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

lectin

Xerocomus chrysenteron

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	SULFATE ION × 10 1,2-ETHANEDIOL × 6 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8WZC9_9HOMO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–145； UniProt 1–143 Author chain B； PDBConstruct 3–145； UniProt 1–143

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1x99
Deposition date deposition_date	2004-08-20
Structure title title	X-ray crystal structure of Xerocomus chrysenteron lectin XCL at 1.4 Angstroms resolution, mutated at Q46M, V54M, L58M
Keywords keywords	fungal lectin, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1x99__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1x99__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1x99__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.49 Å
Rg (electron density)	24.21 Å
Total Rg	25.06 Å
Atom count	4510
Residues	560
Excluded volume	79506 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1x99__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	lectin
Molecular weight formula_weight	16272.6 kDa
Mutation mutation	Q48M, V56M, L60M
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2434

GHMSYSITLRVYQTNRDRGYFSIVEKTVWHFANGGTWSEANGAHTLTMGGSGTSGMLRFMSTKGERITVAVGVHNYKRWCDVVTGLKPDETALVINPQYYNNGGRDYVREKQLAEYSVTSAIGTKVEVVYTVAEGNNLEANVIFS

Source Source

Source organism organism	Xerocomus chrysenteron
NCBI taxonomy ID ncbi_taxonomy_id	5386
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	164

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1x99a1
Class class	b — All beta proteins
Fold Fold fold	b.97 — Cytolysin/lectin
Superfamily Superfamily superfamily	b.97.1 — Cytolysin/lectin
Family Family family	b.97.1.2 — Fungal fruit body lectin

Domain ID domain_id	d1x99a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1x99b_
Class class	b — All beta proteins
Fold Fold fold	b.97 — Cytolysin/lectin
Superfamily Superfamily superfamily	b.97.1 — Cytolysin/lectin
Family Family family	b.97.1.2 — Fungal fruit body lectin

CATH v4.4 (2 domains)

Domain ID domain_id	1x99A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 — Cytolysin/lectin

Domain ID domain_id	1x99B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 — Cytolysin/lectin

▶

Unit-cell length a length_a	59.153 Å
Unit-cell length b length_b	59.153 Å
Unit-cell length c length_c	149.663 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	1.400 Å
Low-resolution limit resolution_low	51.300 Å
R factor r_factor	0.1745
R_work r_work	0.1738
R_free r_free	0.1874

X-ray crystal structure of Xerocomus chrysenteron lectin XCL at 1.4 Angstroms resolution, mutated at Q46M, V54M, L58M

1. Protein Identity and Related Structures Protein Identity & Related Structures

lectin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1x99__assembly_1__model_1

1x99__assembly_1__model_1 | I(q)

1x99__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)

X-ray crystal structure of Xerocomus chrysenteron lectin XCL at 1.4 Angstroms resolution, mutated at Q46M, V54M, L58M

1. Protein Identity and Related Structures Protein Identity & Related Structures

lectin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1x99__assembly_1__model_1

1x99__assembly_1__model_1 | I(q)

1x99__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)