SAXSdb — 1y82

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein

Pyrococcus furiosus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	UNKNOWN ATOM OR ION × 42 water × 4	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	UNKNOWN ATOM OR ION × 22 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	UNKNOWN ATOM OR ION × 20 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U3V0_PYRFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–157； UniProt 4–151 Author chain B； PDBConstruct 10–157； UniProt 4–151 Author chain C； PDBConstruct 10–157； UniProt 4–151 Author chain D； PDBConstruct 10–157； UniProt 4–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1y82
Deposition date deposition_date	2004-12-10
Structure title title	Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus
Keywords keywords	;Structural Genomics, conserved hypothetical protein, SECSG, PSI, Southeast Collaboratory for Structural Genomics, Protein Structure Initiative, Pyrococcus furiosus, Pfu-367848-001, hyperthermophile, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1y82__assembly_1__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： The source record does not identify the atom or ion element unambiguously, so a reliable calculation is not possible.
2	1	`1y82__assembly_2__model_1`	dimeric （2）	Excluded	—	—
	Exclusion reason： The source record does not identify the atom or ion element unambiguously, so a reliable calculation is not possible.
3	1	`1y82__assembly_3__model_1`	dimeric （2）	Excluded	—	—
	Exclusion reason： The source record does not identify the atom or ion element unambiguously, so a reliable calculation is not possible.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	hypothetical protein
Molecular weight formula_weight	18462.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4554

AHHHHHHGSPLPPDITFDSLALIKMHSQSMKKILEITLAKFTVNLSIVTVYRYLTVRAYLKKNIELELDVLKDIYNIVPLNEEIAIKAAQIEADLMRKGMMPDIEDVLTAATAIYTKSLLITDDSKRYEPMRRFGLDTMPLDKFVKEVELMVEKELI

Source Source

Source organism organism	Pyrococcus furiosus
NCBI taxonomy ID ncbi_taxonomy_id	2261
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	UNKNOWN ATOM OR ION
Source method src_method	syn
Copy count entity_count	42

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	39

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1y82a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.120 — PIN domain-like
Superfamily Superfamily superfamily	c.120.1 — PIN domain-like
Family Family family	c.120.1.1 — PIN domain

Domain ID domain_id	d1y82b_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.120 — PIN domain-like
Superfamily Superfamily superfamily	c.120.1 — PIN domain-like
Family Family family	c.120.1.1 — PIN domain

Domain ID domain_id	d1y82c_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.120 — PIN domain-like
Superfamily Superfamily superfamily	c.120.1 — PIN domain-like
Family Family family	c.120.1.1 — PIN domain

Domain ID domain_id	d1y82d_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.120 — PIN domain-like
Superfamily Superfamily superfamily	c.120.1 — PIN domain-like
Family Family family	c.120.1.1 — PIN domain

CATH v4.4 (4 domains)

Domain ID domain_id	1y82A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1010 — 5'-nuclease

Domain ID domain_id	1y82B00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1010 — 5'-nuclease

Domain ID domain_id	1y82C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1010 — 5'-nuclease

Domain ID domain_id	1y82D00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1010 — 5'-nuclease

▶

Unit-cell length a length_a	57.601 Å
Unit-cell length b length_b	103.667 Å
Unit-cell length c length_c	104.253 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	73.521 Å
R factor r_factor	0.2235
R_work r_work	0.2216
R_free r_free	0.2779

Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Conserved hypothetical protein Pfu-367848-001 from Pyrococcus furiosus

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)