SAXSdb — 1yfn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Stringent starvation protein B

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor negative regulatory protein × 2 （P38106） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor negative regulatory protein × 2 （P38106） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SSPB_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–118； UniProt 1–118 Author chain B； PDBConstruct 1–118； UniProt 1–118 Author chain C； PDBConstruct 1–118； UniProt 1–118 Author chain D； PDBConstruct 1–118； UniProt 1–118

Sigma-E factor negative regulatory protein

OrganismNot specified

UniProt P38106

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Stringent starvation protein B × 2 （P0AFZ3） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Stringent starvation protein B × 2 （P0AFZ3） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSEA_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–23； UniProt 77–108 Author chain F； PDBConstruct 1–23； UniProt 77–108 Author chain G； PDBConstruct 1–23； UniProt 77–108 Author chain H； PDBConstruct 1–23； UniProt 77–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1yfn
Deposition date deposition_date	2005-01-03
Structure title title	Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex
Keywords keywords	protein-peptide complex, sspB, rseA, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1yfn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1yfn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1yfn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.58 Å
Rg (electron density)	20.64 Å
Total Rg	21.47 Å
Atom count	1989
Residues	249
Excluded volume	35445 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1yfn__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1yfn__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Stringent starvation protein B
Molecular weight formula_weight	13168.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4154

MDLSQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYDEDTSIMN

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Sigma-E factor negative regulatory protein
Molecular weight formula_weight	3722.3 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

EAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAA

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	215

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1yfna_
Class class	b — All beta proteins
Fold Fold fold	b.136 — SspB-like
Superfamily Superfamily superfamily	b.136.1 — SspB-like
Family Family family	b.136.1.1 — Stringent starvation protein B, SspB

Domain ID domain_id	d1yfnb_
Class class	b — All beta proteins
Fold Fold fold	b.136 — SspB-like
Superfamily Superfamily superfamily	b.136.1 — SspB-like
Family Family family	b.136.1.1 — Stringent starvation protein B, SspB

Domain ID domain_id	d1yfnc_
Class class	b — All beta proteins
Fold Fold fold	b.136 — SspB-like
Superfamily Superfamily superfamily	b.136.1 — SspB-like
Family Family family	b.136.1.1 — Stringent starvation protein B, SspB

Domain ID domain_id	d1yfnd_
Class class	b — All beta proteins
Fold Fold fold	b.136 — SspB-like
Superfamily Superfamily superfamily	b.136.1 — SspB-like
Family Family family	b.136.1.1 — Stringent starvation protein B, SspB

CATH v4.4 (4 domains)

Domain ID domain_id	1yfnA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	220 — SspB-like

Domain ID domain_id	1yfnB00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	220 — SspB-like

Domain ID domain_id	1yfnC00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	220 — SspB-like

Domain ID domain_id	1yfnD00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	220 — SspB-like

▶

Unit-cell length a length_a	69.647 Å
Unit-cell length b length_b	60.533 Å
Unit-cell length c length_c	88.576 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.62 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	29.430 Å
R factor r_factor	0.2410
R_work r_work	0.2340
R_free r_free	0.2610

Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Stringent starvation protein B

State in the Current Structure

Other States of the Same Protein in the Database

Sigma-E factor negative regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1yfn__assembly_1__model_1

1yfn__assembly_1__model_1 | I(q)

1yfn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Versatile modes of peptide recognition by the AAA+ adaptor protein SspB- the crystal structure of a SspB-RseA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Stringent starvation protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sigma-E factor negative regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1yfn__assembly_1__model_1

1yfn__assembly_1__model_1 | I(q)

1yfn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)