SAXSdb — 1ylk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein Rv1284/MT1322

Mycobacterium tuberculosis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 2 THIOCYANATE ION × 3 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 2 THIOCYANATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y1284_MYCTU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–172； UniProt 2–163 Author chain B； PDBConstruct 11–172； UniProt 2–163 Author chain C； PDBConstruct 11–172； UniProt 2–163 Author chain D； PDBConstruct 11–172； UniProt 2–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ylk
Deposition date deposition_date	2005-01-19
Structure title title	Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate
Keywords keywords	Rv1284, homodimer, alpha/beta-fold, Structural Proteomics in Europe, SPINE, Structural Genomics, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ylk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ylk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ylk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.62 Å
Rg (electron density)	18.39 Å
Total Rg	19.22 Å
Atom count	2553
Residues	326
Excluded volume	45295 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ylk__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ylk__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein Rv1284/MT1322
Molecular weight formula_weight	19255.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	5371

MAHHHHHHSGTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	THIOCYANATE ION
Molecular weight formula_weight	58.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	268

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1ylka1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.53 — Resolvase-like
Superfamily Superfamily superfamily	c.53.2 — beta-carbonic anhydrase, cab
Family Family family	c.53.2.0 — automated matches

Domain ID domain_id	d1ylka2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1ylkb1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.53 — Resolvase-like
Superfamily Superfamily superfamily	c.53.2 — beta-carbonic anhydrase, cab
Family Family family	c.53.2.0 — automated matches

Domain ID domain_id	d1ylkb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1ylkc1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.53 — Resolvase-like
Superfamily Superfamily superfamily	c.53.2 — beta-carbonic anhydrase, cab
Family Family family	c.53.2.0 — automated matches

Domain ID domain_id	d1ylkc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1ylkd1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.53 — Resolvase-like
Superfamily Superfamily superfamily	c.53.2 — beta-carbonic anhydrase, cab
Family Family family	c.53.2.0 — automated matches

Domain ID domain_id	d1ylkd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	1ylkA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1050 — Beta-carbonic Anhydrase; Chain A
Homologous superfamily homologous superfamily	10 — Carbonic anhydrase

Domain ID domain_id	1ylkB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1050 — Beta-carbonic Anhydrase; Chain A
Homologous superfamily homologous superfamily	10 — Carbonic anhydrase

Domain ID domain_id	1ylkC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1050 — Beta-carbonic Anhydrase; Chain A
Homologous superfamily homologous superfamily	10 — Carbonic anhydrase

Domain ID domain_id	1ylkD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1050 — Beta-carbonic Anhydrase; Chain A
Homologous superfamily homologous superfamily	10 — Carbonic anhydrase

▶

Unit-cell length a length_a	100.164 Å
Unit-cell length b length_b	154.074 Å
Unit-cell length c length_c	156.943 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	64

Space group space_group	F 2 2 2
Space-group number int_tables_number	22
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	42.260 Å
R factor r_factor	0.1831
R_work r_work	0.1808
R_free r_free	0.2265

Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein Rv1284/MT1322

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ylk__assembly_1__model_1

1ylk__assembly_1__model_1 | I(q)

1ylk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein Rv1284/MT1322

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ylk__assembly_1__model_1

1ylk__assembly_1__model_1 | I(q)

1ylk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

CATH v4.4 (4 domains)

7. Citations (1)