SAXSdb — 1zaw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L10

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	50S ribosomal protein L7/L12 × 6 （P29396） water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–180； UniProt 1–179

50S ribosomal protein L7/L12

Thermotoga maritima

UniProt P29396

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	50S ribosomal protein L10 × 1 （P29394） water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain U； PDBConstruct 1–30； UniProt 1–30 Author chain V； PDBConstruct 1–30； UniProt 1–30 Author chain W； PDBConstruct 1–30； UniProt 1–30 Author chain X； PDBConstruct 1–30； UniProt 1–30 Author chain Y； PDBConstruct 1–30； UniProt 1–30 Author chain Z； PDBConstruct 1–30； UniProt 1–30

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1zaw
Deposition date deposition_date	2005-04-07
Structure title title	Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form A
Keywords keywords	;ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk, thiostrepton loop of 23S rRNA, translation factor recruitment, GTPase stimulation, mechanism of translation, rapid kinetics, STRUCTURAL PROTEIN ;; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1zaw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1zaw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1zaw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.47 Å
Rg (electron density)	30.31 Å
Total Rg	31.06 Å
Atom count	2818
Residues	345
Excluded volume	51851 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1zaw__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	50S ribosomal protein L10
Molecular weight formula_weight	20577.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3041

VMLTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEKKSE

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	50S ribosomal protein L7/L12
Molecular weight formula_weight	3456.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V,W,X,Y,Z

MTIDEIIEAIEKLTVSELAELVKKLEDKFG

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	223

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1zawa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.62 — Ribosomal protein L10-like
Family Family family	d.58.62.1 — Ribosomal protein L10-like

Domain ID domain_id	d1zawa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1zawu1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

Domain ID domain_id	d1zawv1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

Domain ID domain_id	d1zaww1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

Domain ID domain_id	d1zawx1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

Domain ID domain_id	d1zawy1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

Domain ID domain_id	d1zawz1
Class class	a — All alpha proteins
Fold Fold fold	a.108 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Superfamily Superfamily superfamily	a.108.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain
Family Family family	a.108.1.1 — Ribosomal protein L7/12, oligomerisation (N-terminal) domain

CATH v4.4 (2 domains)

Domain ID domain_id	1zawA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1730 — Ribosomal protein L10, N-terminal RNA-binding domain

Domain ID domain_id	1zawA02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	290 —

▶

Unit-cell length a length_a	84.934 Å
Unit-cell length b length_b	84.933 Å
Unit-cell length c length_c	63.939 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2330
R_work r_work	0.2220
R_free r_free	0.2720

Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form A

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L10

State in the Current Structure

Other States of the Same Protein in the Database

50S ribosomal protein L7/L12

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1zaw__assembly_1__model_1

1zaw__assembly_1__model_1 | I(q)

1zaw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (8 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form A

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L7/L12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1zaw__assembly_1__model_1

1zaw__assembly_1__model_1 | I(q)

1zaw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (8 domains)

CATH v4.4 (2 domains)

7. Citations (1)