SAXSdb — 2aff

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antigen KI-67

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–120	Fragment：FHA domain	MKI67 FHA domain interacting nucleolar phosphoprotein × 1 （Q9BYG3）	SOLUTION NMR NMR measurement conditions：pH 7.4；293 K；Ionic strength (raw mmCIF value) 150 mM NaCl；Pressure ambient NMR sample composition：0.9 mM Ki67 FHA U-15N,13C; 1 mM hNIFK(226-269)3P unlabeled 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 93% H2O/7% D2O NMR sample composition：0.9 mM Ki67 FHA U-15N,13C; 1 mM hNIFK(226-269)3P unlabeled 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 100% D2O NMR sample composition：1 mM Ki67 FHA unlabled; 0.9 mM hNIFK(226-269)3P U-15N,13C 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 93% H2O/7% D2O NMR sample composition：1 mM Ki67 FHA unlabled; 0.9 mM hNIFK(226-269)3P U-15N,13C 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 100% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2AFF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1R21 Solution Structure of human Ki67 FHA Domain Deposited 2003-09-25	Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–120（120 aa） Fragment：FHA domain	Mutation：none	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 8.4；290 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR measurement conditions pH 7.5；290 K；Ionic strength (raw mmCIF value) 150 mM NaCl；Pressure ambient NMR sample composition 0.5 mM U-13C,15N-protein; 10 mM TrisHCl buffer (pH 8.4); 2mM DTT; 1 mM EDTA \| 95% H2O, 10% D2O NMR sample composition 0.5 mM U-13C,15N-protein; 5 mM HEPES buffer (pH 7.5); 2mM DTT; 1 mM EDTA; 150 mM NaCl \| 95% H2O, 10% D2O NMR sample composition 0.5 mM unlabeled-protein; 10 mM TrisHCl buffer (pH 8.4); 2mM DTT; 1 mM EDTA \| 95% H2O, 10% D2O NMR sample composition 0.5 mM unlabeled-protein; 10 mM TrisHCl buffer (pH 8.4); 2mM DTT; 1 mM EDTA \| 100% D2O	Resolution not provided
5J28 Ki67-PP1g (protein phosphatase 1, gamma isoform) holoenzyme complex Deposited 2016-03-29	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 496–536（41 aa） Fragment：UNP residues 496-536	Mutation：T525M	MLI MALONATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；1.9 M Sodium Malonate pH 4.0	Resolution 2.00 Å R-free 0.197
5J28 Ki67-PP1g (protein phosphatase 1, gamma isoform) holoenzyme complex Deposited 2016-03-29	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 496–536（41 aa） Fragment：UNP residues 496-536	Mutation：T525M	MLI MALONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；277 K；1.9 M Sodium Malonate pH 4.0	Resolution 2.00 Å R-free 0.197

2 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KI67_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–120； UniProt 1–120

MKI67 FHA domain interacting nucleolar phosphoprotein

Homo sapiens

UniProt Q9BYG3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 226–269	Fragment：residues 226-269 Non-standard monomer：Yes (specific site not provided by mmCIF)	Antigen KI-67 × 1 （P46013）	SOLUTION NMR NMR measurement conditions：pH 7.4；293 K；Ionic strength (raw mmCIF value) 150 mM NaCl；Pressure ambient NMR sample composition：0.9 mM Ki67 FHA U-15N,13C; 1 mM hNIFK(226-269)3P unlabeled 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 93% H2O/7% D2O NMR sample composition：0.9 mM Ki67 FHA U-15N,13C; 1 mM hNIFK(226-269)3P unlabeled 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 100% D2O NMR sample composition：1 mM Ki67 FHA unlabled; 0.9 mM hNIFK(226-269)3P U-15N,13C 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 93% H2O/7% D2O NMR sample composition：1 mM Ki67 FHA unlabled; 0.9 mM hNIFK(226-269)3P U-15N,13C 5 mM HEPES, 5 mM DTT, 1 mM EDTA, 150 mM NaCl, pH 7.4 \| 100% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2AFF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8FKP Human nucleolar pre-60S ribosomal subunit (State A1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 54 ZN ZINC ION × 2 SF4 IRON/SULFUR CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the Vitrobot.	Resolution 2.85 Å
8FKQ Human nucleolar pre-60S ribosomal subunit (State A2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 43-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 51 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.76 Å
8FKR Human nucleolar pre-60S ribosomal subunit (State B1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 51-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 54 ZN ZINC ION × 2 SF4 IRON/SULFUR CLUSTER × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.89 Å
8FKS Human nucleolar pre-60S ribosomal subunit (State B2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 61 ZN ZINC ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.88 Å
8FKT Human nucleolar pre-60S ribosomal subunit (State C1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 64 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SF4 IRON/SULFUR CLUSTER × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.81 Å
8FKU Human nucleolar pre-60S ribosomal subunit (State C2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 47 PDB declaration: 50-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 58 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.82 Å
8FKV Human nucleolar pre-60S ribosomal subunit (State D1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 56-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 65 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 SF4 IRON/SULFUR CLUSTER × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.47 Å
8FKW Human nucleolar pre-60S ribosomal subunit (State D2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 59 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.50 Å
8FKX Human nucleolar pre-60S ribosomal subunit (State E) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 61 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.59 Å
8FKY Human nucleolar pre-60S ribosomal subunit (State F) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 59-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 70 ZN ZINC ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.67 Å
8FKZ Human nucleolar pre-60S ribosomal subunit (State G) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 51-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 64 ZN ZINC ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 3.04 Å
8FL2 Human nuclear pre-60S ribosomal subunit (State I1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 61 PDB declaration: 65-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 100 ZN ZINC ION × 5 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 K POTASSIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.67 Å
8FL3 Human nuclear pre-60S ribosomal subunit (State I2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 60 PDB declaration: 63-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 100 ZN ZINC ION × 5 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 K POTASSIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.53 Å
8FL6 Human nuclear pre-60S ribosomal subunit (State J1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 56-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 88 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.62 Å
8FL7 Human nuclear pre-60S ribosomal subunit (State J2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 51 PDB declaration: 54-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 88 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.55 Å
8FLA Human nuclear pre-60S ribosomal subunit (State K1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 56-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 88 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.63 Å
8FLB Human nuclear pre-60S ribosomal subunit (State K2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 51 PDB declaration: 54-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 88 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the vitrobot.	Resolution 2.55 Å
8FLD Human nuclear pre-60S ribosomal subunit (State L1) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 54-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 87 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the Vitrobot.	Resolution 2.58 Å
8FLE Human nuclear pre-60S ribosomal subunit (State L2) Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 52-meric	Chain SH 1–293（293 aa）	Not recorded	MG MAGNESIUM ION × 87 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Four applications with manual blotting before last blotting with the Vitrobot.	Resolution 2.48 Å
8INE human nuclear pre-60S ribosomal particle - State G' Deposited 2023-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 58-meric	Chain t 1–293（293 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8INF human nuclear pre-60S ribosomal particle - State F' Deposited 2023-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 61-meric	Chain t 1–293（293 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 K POTASSIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8IPX human nuclear pre-60S ribosomal particle - State C' Deposited 2023-03-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 58-meric	Chain t 1–293（293 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
8IPY human nuclear pre-60S ribosomal particle - State D' Deposited 2023-03-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 59-meric	Chain t 1–293（293 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8IR3 human nuclear pre-60S ribosomal particle - State B' Deposited 2023-03-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 59-meric	Chain t 1–293（293 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MK67I_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–44； UniProt 226–269

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2aff
Deposition date deposition_date	2005-07-25
Structure title title	The solution structure of the Ki67FHA/hNIFK(226-269)3P complex
Keywords keywords	Ki67; FHA; NIFK; NMR; Phosphoprotein, CELL CYCLE; CELL CYCLE
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	15.15 Å
Radius of gyration Rg (electron density) rg_electron	14.70 Å
Forward intensity I(0) i0	37653700000.00
Molecular weight molecular_weight	1584200.0 kDa
Excluded volume excluded_volume	1953000 Å³
Envelope volume envelope_volume	33045 Å³
Hydration-shell volume shell_volume	16663 Å³
Envelope diameter envelope_diameter	55.5 Å
Shell Rg shell_rg	22.72 Å
Envelope Rg envelope_rg	16.81 Å
Shape Rg shape_rg	14.69 Å
Total Rg total_rg	14.77 Å
Total atoms total_atoms	220300
Residues n_residues	13500
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	48.4 Å
Rg (real space) rg_real	15.05 Å
Rg uncertainty (real space) rg_real_error	0.36 Å
I(0) (real space) i0_real	3.7650e+10
I(0) uncertainty (real space) i0_real_error	4.7720e+08
Rg (reciprocal space) rg_reciprocal	15.06 Å
I(0) (reciprocal space) i0_reciprocal	37650000000.0000
Solution quality estimate total_estimate	0.8897
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	20.2 Å
Skewness Skewness skewness	0.145
Kurtosis Kurtosis kurtosis	-0.304
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	383400.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.858; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.998; Smooth: 0.993

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Antigen KI-67
Molecular weight formula_weight	13826.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	220300

MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	MKI67 FHA domain interacting nucleolar phosphoprotein
Molecular weight formula_weight	5197.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

KTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2affa_
Class class	b — All beta proteins
Fold Fold fold	b.26 — SMAD/FHA domain
Superfamily Superfamily superfamily	b.26.1 — SMAD/FHA domain
Family Family family	b.26.1.2 — FHA domain

CATH v4.4 (1 domains)

Domain ID domain_id	2affA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	200 — Tumour Suppressor Smad4
Homologous superfamily homologous superfamily	20 —

▶

8. Citations (2)

▶

fit	/app/data/saxs_computation/af/2aff/2aff.fit
pddf	/app/data/pr_computation/af/2aff/2aff.pr.out
profile	/app/data/saxs_computation/af/2aff/2aff.dat

The solution structure of the Ki67FHA/hNIFK(226-269)3P complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antigen KI-67

State in the Current Structure

Other States of the Same Protein in the Database

MKI67 FHA domain interacting nucleolar phosphoprotein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)