2ahm

Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replicase polyprotein 1ab, light chain

SARS coronavirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 16	GLYCEROL × 10 SULFATE ION × 2 water × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	R1AB_CVHSA
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 6–88； UniProt 3837–3919 Author chain B； PDBConstruct 6–88； UniProt 3837–3919 Author chain C； PDBConstruct 6–88； UniProt 3837–3919 Author chain D； PDBConstruct 6–88； UniProt 3837–3919 Author chain E； PDBConstruct 6–203； UniProt 3920–4117 Author chain F； PDBConstruct 6–203； UniProt 3920–4117 Author chain G； PDBConstruct 6–203； UniProt 3920–4117 Author chain H； PDBConstruct 6–203； UniProt 3920–4117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ahm
Deposition date deposition_date	2005-07-28
Structure title title	Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer
Keywords keywords	SARS-CoV, coronavirus, non-structural protein, nsp7, nsp8, super-complex, hexadecamer, Viral protein, Replication; Viral protein, Replication
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ahm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ahm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ahm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.98 Å
Rg (electron density)	40.98 Å
Total Rg	41.25 Å
Atom count	15266
Residues	1968
Excluded volume	274130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ahm__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Replicase polyprotein 1ab, light chain
Molecular weight formula_weight	9688.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	7782

GPLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQ

Source Source

Source organism organism	SARS coronavirus
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Replicase polyprotein 1ab, heavy chain
Molecular weight formula_weight	22299.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

GPLGSAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQ

Source Source

Source organism organism	SARS coronavirus
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d2ahma1
Class class	a — All alpha proteins
Fold Fold fold	a.8 — immunoglobulin/albumin-binding domain-like
Superfamily Superfamily superfamily	a.8.9 — Coronavirus NSP7-like
Family Family family	a.8.9.1 — Coronavirus NSP7-like

Domain ID domain_id	d2ahma2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ahmb2
Class class	a — All alpha proteins
Fold Fold fold	a.8 — immunoglobulin/albumin-binding domain-like
Superfamily Superfamily superfamily	a.8.9 — Coronavirus NSP7-like
Family Family family	a.8.9.1 — Coronavirus NSP7-like

Domain ID domain_id	d2ahmb3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ahmc2
Class class	a — All alpha proteins
Fold Fold fold	a.8 — immunoglobulin/albumin-binding domain-like
Superfamily Superfamily superfamily	a.8.9 — Coronavirus NSP7-like
Family Family family	a.8.9.1 — Coronavirus NSP7-like

Domain ID domain_id	d2ahmc3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ahmd2
Class class	a — All alpha proteins
Fold Fold fold	a.8 — immunoglobulin/albumin-binding domain-like
Superfamily Superfamily superfamily	a.8.9 — Coronavirus NSP7-like
Family Family family	a.8.9.1 — Coronavirus NSP7-like

Domain ID domain_id	d2ahmd3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ahme1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.302 — Coronavirus NSP8-like
Superfamily Superfamily superfamily	d.302.1 — Coronavirus NSP8-like
Family Family family	d.302.1.1 — Coronavirus NSP8-like

Domain ID domain_id	d2ahmf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.302 — Coronavirus NSP8-like
Superfamily Superfamily superfamily	d.302.1 — Coronavirus NSP8-like
Family Family family	d.302.1.1 — Coronavirus NSP8-like

Domain ID domain_id	d2ahmg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.302 — Coronavirus NSP8-like
Superfamily Superfamily superfamily	d.302.1 — Coronavirus NSP8-like
Family Family family	d.302.1.1 — Coronavirus NSP8-like

Domain ID domain_id	d2ahmh1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.302 — Coronavirus NSP8-like
Superfamily Superfamily superfamily	d.302.1 — Coronavirus NSP8-like
Family Family family	d.302.1.1 — Coronavirus NSP8-like

CATH v4.4 (12 domains)

Domain ID domain_id	2ahmA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	370 — nsp7 replicase

Domain ID domain_id	2ahmB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	370 — nsp7 replicase

Domain ID domain_id	2ahmC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	370 — nsp7 replicase

Domain ID domain_id	2ahmD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	370 — nsp7 replicase

Domain ID domain_id	2ahmE01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	580 —

Domain ID domain_id	2ahmE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3540 — Nsp8 replicase, head domain

Domain ID domain_id	2ahmF01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	580 —

Domain ID domain_id	2ahmF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3540 — Nsp8 replicase, head domain

Domain ID domain_id	2ahmG01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2820 —

Domain ID domain_id	2ahmG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3540 — Nsp8 replicase, head domain

Domain ID domain_id	2ahmH01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2820 —

Domain ID domain_id	2ahmH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3540 — Nsp8 replicase, head domain

▶

Unit-cell length a length_a	93.600 Å
Unit-cell length b length_b	94.000 Å
Unit-cell length c length_c	150.800 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2320
R_work r_work	0.2130
R_free r_free	0.2510

Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replicase polyprotein 1ab, light chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ahm__assembly_1__model_1

2ahm__assembly_1__model_1 | I(q)

2ahm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)

Crystal structure of SARS-CoV super complex of non-structural proteins: the hexadecamer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replicase polyprotein 1ab, light chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ahm__assembly_1__model_1

2ahm__assembly_1__model_1 | I(q)

2ahm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

CATH v4.4 (12 domains)

7. Citations (1)