SAXSdb — 2b1y

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein Atu1913

Agrobacterium tumefaciens str.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 6 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8UE48_AGRT5
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–104； UniProt 1–104

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2b1y
Deposition date deposition_date	2005-09-16
Structure title title	Crystal Structure of Protein of Unknown Function ATU1913 from Agrobacterium tumefaciens str. C58
Keywords keywords	;hypothetical protein, new fold, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2b1y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2b1y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2b1y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.62 Å
Rg (electron density)	22.14 Å
Total Rg	23.11 Å
Atom count	1620
Residues	196
Excluded volume	28858 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2b1y__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	hypothetical protein Atu1913
Molecular weight formula_weight	11847.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	918

MARPNFRYTHYDLKELRAGTTLEISLSSVNNVRLMTGANFQRFTELLDFKYLGGVAKKSPIRIAVPETMHWHLIIDAEGHSGLAESSVKMLPAQPQATLTRKAS

Source Source

Source organism organism	Agrobacterium tumefaciens str.
NCBI taxonomy ID ncbi_taxonomy_id	176299
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	71

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2b1ya1
Class class	b — All beta proteins
Fold Fold fold	b.156 — Atu1913-like
Superfamily Superfamily superfamily	b.156.1 — Atu1913-like
Family Family family	b.156.1.1 — Atu1913-like

CATH v4.4 (1 domains)

Domain ID domain_id	2b1yA00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1210 — Atu1913-like
Homologous superfamily homologous superfamily	10 — Atu1913-like

▶

Unit-cell length a length_a	40.428 Å
Unit-cell length b length_b	99.646 Å
Unit-cell length c length_c	55.827 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	49.810 Å
R factor r_factor	0.2129
R_work r_work	0.2125
R_free r_free	0.2207

Crystal Structure of Protein of Unknown Function ATU1913 from Agrobacterium tumefaciens str. C58

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein Atu1913

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2b1y__assembly_1__model_1

2b1y__assembly_1__model_1 | I(q)

2b1y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal Structure of Protein of Unknown Function ATU1913 from Agrobacterium tumefaciens str. C58

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein Atu1913

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2b1y__assembly_1__model_1

2b1y__assembly_1__model_1 | I(q)

2b1y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)