SAXSdb — 2btj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

Lobophyllia hemprichii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5S6Z9_LOBHE
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain aa； PDBConstruct 3–61； UniProt 3–61 Author chain bb； PDBConstruct 3–61； UniProt 3–61 Author chain cc； PDBConstruct 3–61； UniProt 3–61 Author chain dd； PDBConstruct 3–61； UniProt 3–61 Author chain A； PDBConstruct 1–159； UniProt 62–222 Author chain B； PDBConstruct 1–159； UniProt 62–222 Author chain C； PDBConstruct 1–159； UniProt 62–222 Author chain D； PDBConstruct 1–159； UniProt 62–222

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2btj
Deposition date deposition_date	2005-06-01
Structure title title	Fluorescent Protein EosFP - red form
Keywords keywords	PHOTO-INDUCED PROTEIN CLEAVAGE, GREEN-TO-RED CONVERSION, FLUORESCENT PROTEIN, LUMINESCENT PROTEIN; FLUORESCENT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2btj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2btj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2btj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.56 Å
Rg (electron density)	27.58 Å
Total Rg	28.50 Å
Atom count	7100
Residues	872
Excluded volume	125590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2btj__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Green to red photoconvertible GFP-like protein EosFP
Molecular weight formula_weight	6553.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aa,bb,cc,dd
Atom count atom_count	7796

GGAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAF

Source Source

Source organism organism	Lobophyllia hemprichii
Common name common_name	Lobed brain coral
NCBI taxonomy ID ncbi_taxonomy_id	46758
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	Green to red photoconvertible GFP-like protein EosFP
Molecular weight formula_weight	18651.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

XNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPD

Source Source

Source organism organism	Lobophyllia hemprichii
Common name common_name	Lobed brain coral
NCBI taxonomy ID ncbi_taxonomy_id	46758
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	696

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2btja_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2btjb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2btjc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2btjd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

▶

Unit-cell length a length_a	70.590 Å
Unit-cell length b length_b	105.510 Å
Unit-cell length c length_c	119.620 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1981
R_work r_work	0.1981
R_free r_free	0.2317

Fluorescent Protein EosFP - red form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2btj__assembly_1__model_1

2btj__assembly_1__model_1 | I(q)

2btj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)

Fluorescent Protein EosFP - red form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2btj__assembly_1__model_1

2btj__assembly_1__model_1 | I(q)

2btj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)