SAXSdb — 2vvj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

Lobophyllia hemprichii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	SULFATE ION × 15 SULFITE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5S6Z9_LOBHE
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain aa； PDBConstruct 3–63； UniProt 1–61 Author chain bb； PDBConstruct 3–63； UniProt 1–61 Author chain cc； PDBConstruct 3–63； UniProt 1–61 Author chain dd； PDBConstruct 3–63； UniProt 1–61 Author chain A； PDBConstruct 1–163； UniProt 62–226 Author chain B； PDBConstruct 1–163； UniProt 62–226 Author chain C； PDBConstruct 1–163； UniProt 62–226 Author chain D； PDBConstruct 1–163； UniProt 62–226

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2vvj
Deposition date deposition_date	2008-06-09
Structure title title	IrisFP fluorescent protein in its red form, cis conformation
Keywords keywords	;PHOTOACTIVATION, PHOTOCONVERSION, FLUORESCENT PROTEIN, OPTICAL HIGHLIGHTERS, MICROSPECTROPHOTOMETRY, EOSFP, PHOTOCHROMISM, PHOTOSWITCHING ;; FLUORESCENT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2vvj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2vvj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2vvj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.86 Å
Rg (electron density)	27.87 Å
Total Rg	28.83 Å
Atom count	7203
Residues	873
Excluded volume	126890 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2vvj__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Green to red photoconvertible GFP-like protein EosFP
Molecular weight formula_weight	6933.9 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aa,bb,cc,dd
Atom count atom_count	8361

HHMSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAF

Source Source

Source organism organism	Lobophyllia hemprichii
Common name common_name	Lobed brain coral
NCBI taxonomy ID ncbi_taxonomy_id	46758
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	Green to red photoconvertible GFP-like protein EosFP
Molecular weight formula_weight	19056.5 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

XNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Source Source

Source organism organism	Lobophyllia hemprichii
Common name common_name	Lobed brain coral
NCBI taxonomy ID ncbi_taxonomy_id	46758
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 4 Entity 4 non-polymer

Description description	SULFITE ION
Molecular weight formula_weight	80.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	967

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2vvja_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2vvjb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2vvjc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

Domain ID domain_id	d2vvjd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.0 — automated matches

▶

Unit-cell length a length_a	85.670 Å
Unit-cell length b length_b	96.620 Å
Unit-cell length c length_c	140.170 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	45.690 Å
R factor r_factor	0.1885
R_work r_work	0.1863
R_free r_free	0.2324

IrisFP fluorescent protein in its red form, cis conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vvj__assembly_1__model_1

2vvj__assembly_1__model_1 | I(q)

2vvj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)

IrisFP fluorescent protein in its red form, cis conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green to red photoconvertible GFP-like protein EosFP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vvj__assembly_1__model_1

2vvj__assembly_1__model_1 | I(q)

2vvj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)