SAXSdb — 2bw7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ADENYLATE CYCLASE

SPIRULINA PLATENSIS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER × 2 MAGNESIUM ION × 2 CALCIUM ION × 2 2,3,17BETA-TRIHYDROXY-1,3,5(10)-ESTRATRIENE × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER × 2 MAGNESIUM ION × 2 CALCIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O32393_SPIPL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–216； UniProt 1005–1199 Author chain B； PDBConstruct 22–216； UniProt 1005–1199 Author chain C； PDBConstruct 22–216； UniProt 1005–1199 Author chain D； PDBConstruct 22–216； UniProt 1005–1199

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2bw7
Deposition date deposition_date	2005-07-12
Structure title title	A novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen
Keywords keywords	LYASE, ADENYLYL CYCLASE, CAMP SIGNALING, CATECHOL ESTROGEN, INHIBITOR COMPLEX, OXIDOREDUCTASE; LYASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2bw7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2bw7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2bw7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.04 Å
Rg (electron density)	20.90 Å
Total Rg	21.72 Å
Atom count	3124
Residues	391
Excluded volume	55669 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2bw7__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2bw7__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	ADENYLATE CYCLASE
Molecular weight formula_weight	24189.7 kDa
EC 编号 ec_number	4.6.1.1
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	6326

MGSSHHHHHHSSGLVPRGSHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNMLNQ

Source Source

Source organism organism	SPIRULINA PLATENSIS
NCBI taxonomy ID ncbi_taxonomy_id	118562
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER
Molecular weight formula_weight	505.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	2,3,17BETA-TRIHYDROXY-1,3,5(10)-ESTRATRIENE
Molecular weight formula_weight	288.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	139

▼

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d2bw7a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.29 — Nucleotide cyclase
Family Family family	d.58.29.1 — Adenylyl and guanylyl cyclase catalytic domain

Domain ID domain_id	d2bw7a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2bw7b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.29 — Nucleotide cyclase
Family Family family	d.58.29.1 — Adenylyl and guanylyl cyclase catalytic domain

Domain ID domain_id	d2bw7b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2bw7c1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.29 — Nucleotide cyclase
Family Family family	d.58.29.1 — Adenylyl and guanylyl cyclase catalytic domain

Domain ID domain_id	d2bw7c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2bw7d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.29 — Nucleotide cyclase
Family Family family	d.58.29.1 — Adenylyl and guanylyl cyclase catalytic domain

CATH v4.4 (4 domains)

Domain ID domain_id	2bw7A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1230 — Nucleotide cyclase, GGDEF domain

Domain ID domain_id	2bw7B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1230 — Nucleotide cyclase, GGDEF domain

Domain ID domain_id	2bw7C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1230 — Nucleotide cyclase, GGDEF domain

Domain ID domain_id	2bw7D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1230 — Nucleotide cyclase, GGDEF domain

▶

Unit-cell length a length_a	53.400 Å
Unit-cell length b length_b	70.200 Å
Unit-cell length c length_c	106.700 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	96.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2070
R_work r_work	0.2070
R_free r_free	0.2570

A novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen

1. Protein Identity and Related Structures Protein Identity & Related Structures

ADENYLATE CYCLASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2bw7__assembly_1__model_1

2bw7__assembly_1__model_1 | I(q)

2bw7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

CATH v4.4 (4 domains)

7. Citations (1)

A novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen

1. Protein Identity and Related Structures Protein Identity & Related Structures

ADENYLATE CYCLASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2bw7__assembly_1__model_1

2bw7__assembly_1__model_1 | I(q)

2bw7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 11 domains

SCOP 2.08 (7 domains)

CATH v4.4 (4 domains)

7. Citations (1)