SAXSdb — 2cbq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEOCARZINOSTATIN

STREPTOMYCES CARZINOSTATICUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 TESTOSTERONE HEMISUCCINATE × 3 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 TESTOSTERONE HEMISUCCINATE × 3 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 1 TESTOSTERONE HEMISUCCINATE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCZS_STRCZ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–113； UniProt 35–147 Author chain B； PDBConstruct 1–113； UniProt 35–147 Author chain C； PDBConstruct 1–113； UniProt 35–147 Author chain D； PDBConstruct 1–113； UniProt 35–147 Author chain E； PDBConstruct 1–113； UniProt 35–147 Author chain F； PDBConstruct 1–113； UniProt 35–147

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2cbq
Deposition date deposition_date	2006-01-06
Structure title title	Crystal structure of the neocarzinostatin 1Tes15 mutant bound to testosterone hemisuccinate.
Keywords keywords	ANTIBIOTIC, ANTIMICROBIAL, DNA-BINDING, PHAGE-DISPLAY HAPTEN BINDING; ANTIMICROBIAL
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2cbq__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2cbq__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2cbq__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.62 Å
Rg (electron density)	17.32 Å
Total Rg	18.39 Å
Atom count	1623
Residues	224
Excluded volume	28404 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2cbq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2cbq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2cbq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	NEOCARZINOSTATIN
Molecular weight formula_weight	11329.3 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	5016

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVYQRAAVDTGVHASNPADLSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFNH

Source Source

Source organism organism	STREPTOMYCES CARZINOSTATICUS
NCBI taxonomy ID ncbi_taxonomy_id	1897
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	TESTOSTERONE HEMISUCCINATE
Molecular weight formula_weight	388.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	87

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2cbqa_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

Domain ID domain_id	d2cbqb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

Domain ID domain_id	d2cbqc_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

Domain ID domain_id	d2cbqd_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

Domain ID domain_id	d2cbqe_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

Domain ID domain_id	d2cbqf_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.7 — Actinoxanthin-like
Family Family family	b.1.7.1 — Actinoxanthin-like

CATH v4.4 (6 domains)

Domain ID domain_id	2cbqA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

Domain ID domain_id	2cbqB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

Domain ID domain_id	2cbqC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

Domain ID domain_id	2cbqD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

Domain ID domain_id	2cbqE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

Domain ID domain_id	2cbqF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	230 — Neocarzinostatin-like

▶

Unit-cell length a length_a	52.976 Å
Unit-cell length b length_b	97.827 Å
Unit-cell length c length_c	129.268 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2071
R_work r_work	0.2071
R_free r_free	0.2565

Crystal structure of the neocarzinostatin 1Tes15 mutant bound to testosterone hemisuccinate.

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEOCARZINOSTATIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2cbq__assembly_3__model_1

2cbq__assembly_3__model_1 | I(q)

2cbq__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (2)

Crystal structure of the neocarzinostatin 1Tes15 mutant bound to testosterone hemisuccinate.

1. Protein Identity and Related Structures Protein Identity & Related Structures

NEOCARZINOSTATIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2cbq__assembly_3__model_1

2cbq__assembly_3__model_1 | I(q)

2cbq__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (2)