SAXSdb — 2cme

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN 5

HUMAN SARS CORONAVIRUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	DECANE × 1 water × 1	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	DECANE × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	DECANE × 1 water × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	DECANE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y5_CVHSA
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain A； PDBConstruct 1–17； UniProt 9–25 Author chain A； PDBConstruct 18–78； UniProt 38–98 Author chain B； PDBConstruct 1–18； UniProt 9–26 Author chain B； PDBConstruct 19–79； UniProt 38–98 Author chain C； PDBConstruct 1–16； UniProt 10–25 Author chain C； PDBConstruct 17–76； UniProt 39–98 Author chain D； PDBConstruct 1–16； UniProt 10–25 Author chain D； PDBConstruct 17–76； UniProt 39–98 Author chain F； PDBConstruct 1–16； UniProt 10–25 Author chain F； PDBConstruct 17–76； UniProt 39–98 Author chain H； PDBConstruct 1–16； UniProt 10–25 Author chain H； PDBConstruct 17–76； UniProt 39–98 Author chain E； PDBConstruct 1–17； UniProt 9–25 Author chain E； PDBConstruct 18–77； UniProt 39–98 Author chain G； PDBConstruct 1–17； UniProt 9–25 Author chain G； PDBConstruct 18–77； UniProt 39–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2cme
Deposition date deposition_date	2006-05-06
Structure title title	The crystal structure of SARS coronavirus ORF-9b protein
Keywords keywords	ALTERNATIVE OPEN READING FRAME, LIPID-BINDING, VIRUS ASSEMBLY, HYPOTHETICAL PROTEIN; HYPOTHETICAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2cme__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2cme__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2cme__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.22 Å
Rg (electron density)	16.80 Å
Total Rg	17.76 Å
Atom count	1227
Residues	157
Excluded volume	22407 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2cme__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2cme__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2cme__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2cme__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	HYPOTHETICAL PROTEIN 5
Molecular weight formula_weight	8591.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4824

VPPALHLVDPQIQLTITADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK

Source Source

Source organism organism	HUMAN SARS CORONAVIRUS
Common name common_name	SARS
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	HYPOTHETICAL PROTEIN 5
Molecular weight formula_weight	8748.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

VPPALHLVDPQIQLTITRADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK

Source Source

Source organism organism	HUMAN SARS CORONAVIRUS
Common name common_name	SARS
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	HYPOTHETICAL PROTEIN 5
Molecular weight formula_weight	8420.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,F,H

PPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK

Source Source

Source organism organism	HUMAN SARS CORONAVIRUS
Common name common_name	SARS
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	ESCHERICHIA COLI

Entity 4 Entity 4 polymer

Description description	HYPOTHETICAL PROTEIN 5
Molecular weight formula_weight	8519.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G

VPPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK

Source Source

Source organism organism	HUMAN SARS CORONAVIRUS
Common name common_name	SARS
NCBI taxonomy ID ncbi_taxonomy_id	227859
Host organism host_organism	ESCHERICHIA COLI

Entity 5 Entity 5 non-polymer

Description description	DECANE
Molecular weight formula_weight	142.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d2cmea1
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmeb1
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmec_
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmed_
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmee1
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmef_
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmeg_
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

Domain ID domain_id	d2cmeh_
Class class	b — All beta proteins
Fold Fold fold	b.164 — SARS ORF9b-like
Superfamily Superfamily superfamily	b.164.1 — 'SARS ORF9b-like
Family Family family	b.164.1.1 — SARS ORF9b-like

▶

Unit-cell length a length_a	140.028 Å
Unit-cell length b length_b	140.028 Å
Unit-cell length c length_c	45.146 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 42
Space-group number int_tables_number	77
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	19.900 Å
R factor r_factor	0.2660
R_work r_work	0.2660
R_free r_free	0.2890

The crystal structure of SARS coronavirus ORF-9b protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN 5

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2cme__assembly_1__model_1

2cme__assembly_1__model_1 | I(q)

2cme__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

7. Citations (1)

The crystal structure of SARS coronavirus ORF-9b protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2cme__assembly_1__model_1

2cme__assembly_1__model_1 | I(q)

2cme__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

7. Citations (1)