SAXSdb — 2drm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acanthamoeba Myosin IB

Acanthamoeba

UniProt P19706

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	18-mer peptide from Acan125 × 1 SULFATE ION × 5 GLYCEROL × 2 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	18-mer peptide from Acan125 × 1 SULFATE ION × 3 GLYCEROL × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MYSB_ACACA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–58； UniProt 1094–1147 Author chain B； PDBConstruct 5–58； UniProt 1094–1147 Author chain C； PDBConstruct 5–58； UniProt 1094–1147 Author chain D； PDBConstruct 5–58； UniProt 1094–1147

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2drm
Deposition date deposition_date	2006-06-09
Structure title title	Acanthamoeba myosin I SH3 domain bound to Acan125
Keywords keywords	SH3 domain, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2drm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2drm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2drm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.54 Å
Rg (electron density)	15.80 Å
Total Rg	16.81 Å
Atom count	1080
Residues	134
Excluded volume	18835 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2drm__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2drm__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Acanthamoeba Myosin IB
Molecular weight formula_weight	6497.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2408

GPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI

Source Source

Source organism organism	Acanthamoeba
NCBI taxonomy ID ncbi_taxonomy_id	5754
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	18-mer peptide from Acan125
Molecular weight formula_weight	1838.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G

AKPVPPPRGAKPAPPPRT

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	269

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2drmA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

Domain ID domain_id	2drmB00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

Domain ID domain_id	2drmC00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

Domain ID domain_id	2drmD00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

▶

Unit-cell length a length_a	29.969 Å
Unit-cell length b length_b	37.861 Å
Unit-cell length c length_c	44.506 Å
Unit-cell angle α angle_alpha	90.28 °
Unit-cell angle β angle_beta	90.11 °
Unit-cell angle γ angle_gamma	90.64 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.350 Å
Low-resolution limit resolution_low	23.640 Å
R factor r_factor	0.1868
R_work r_work	0.1857
R_free r_free	0.2063

Acanthamoeba myosin I SH3 domain bound to Acan125

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acanthamoeba Myosin IB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2drm__assembly_1__model_1

2drm__assembly_1__model_1 | I(q)

2drm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Acanthamoeba myosin I SH3 domain bound to Acan125

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acanthamoeba Myosin IB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2drm__assembly_1__model_1

2drm__assembly_1__model_1 | I(q)

2drm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)