2ftc

Structural Model for the Large Subunit of the Mammalian Mitochondrial Ribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

39S ribosomal protein L12, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 17 RNA 1	Mitochondrial 16S ribosomal RNA × 1 Mitochondrial ribosomal protein L1 × 1 mitochondrial ribosomal protein L2 × 1 Mitochondrial 39S ribosomal protein L3 × 1 mitochondrial ribosomal protein L4 isoform a × 1 39S ribosomal protein L11, mitochondrial × 1 39S ribosomal protein L13, mitochondrial × 1 Mitochondrial ribosomal protein L16 × 1 Mitochondrial ribosomal protein L17 × 1 39S ribosomal protein L19, mitochondrial × 1 MRPL20 protein × 1 mitochondrial ribosomal protein L22 isoform a × 1 mitochondrial ribosomal protein L24 × 1 Mitochondrial 39S ribosomal protein L27 × 1 mitochondrial ribosomal protein L33 isoform a × 1 39S ribosomal protein L34, mitochondrial × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM12_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–137； UniProt 62–198 Author chain F； PDBConstruct 1–137； UniProt 62–198

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ftc
Deposition date deposition_date	2006-01-24
Structure title title	Structural Model for the Large Subunit of the Mammalian Mitochondrial Ribosome
Keywords keywords	MITOCHONDRIAL RIBOSOME, LARGE RIBOSOMAL SUBUNIT, RIBOSOMAL RNA, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ftc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ftc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ftc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.55 Å
Rg (electron density)	83.07 Å
Total Rg	82.99 Å
Atom count	1443
Residues	1443
Excluded volume	298670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ftc__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Mitochondrial 16S ribosomal RNA
Molecular weight formula_weight	504151.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R
Atom count atom_count	3536

ACUAGACCUAGCCCAAAGAUACCCUCUCGACUAAACAACCAAGAUAGAAUAAAACAAAACAUUUAAUCCCAAUUUAAAGUAUAGGAGAUAGAAAUCUAAGUACGGCGCUAUAGAGAAAGUACCGCAAGGGAACGAUGAAAGAAAAAAACUAAAAGUAUAAAAAAGCAAAGAUUACCCCUUGUACCUUUUGCAUAAUGAAUUAACUAGUAUAAGACUUAACAAAAUGAAUUUUAGCUAAGCAGCCCGAAACCAGACGAGCUACUCACAAACAGUUUACCAAGAACUAACUCAUCUAUGUGGCAAAAUAGUGAGAAGAUUUGUAAGUAGAGGUGACAUGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCAGAAAAUGAAUCUAAGUUCAGCUUUAAAGAUACCAAAAAUUCAAAUAAACCCCACUGUAGCUUUAAAAGUUAGUCUAAAAAGGUACAGCCUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAAUUUAACACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUAAGAAAGCGUUAAAGCUCAACAACAAAAAUUAAAUAGAUUCCAACAACAAAUGAUUAACUCCUAGCCCCAAUACUGGACUAAUCUAUUAUAGAAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAAAAUUUUCUCCUUGCAUAAGUCUAAGUCAGUGCCUGAUAAUACUCUGACCACUAACAGUCAAUAAAAAUAAUCCAACAAUAAACAAUUUAUUGAUUAUACUGUUAACCCAACACAGGAGUGCAUCUAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCCAGCAUUCCCAGUAUUGGAGGCAUUGCCUGCCCAGUGACAACUGUUUAACGGCCGCGGUAUCCUGACCGUGCAAAGGUAGCAUAAUCAUUUGUUCUCUAAAUAAGGACUUGUAUGAAUGGCCGCACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUGACCUUCCCGUGAAGAGGCGGGAAUGCACAAAUAAGACGAGAAGACCCUAUGGAGCUUUAACUAACCAACCCAAAGAGAAUAGAUUUAACCAUUAAGGAAUAACAACAAUCUCCAUGAGUUGGUAGUUUCGGUUGGGGUGACCUCGGAGAAUAAAAAAUCCUCCGAGCGAUUUUAAAGACUAGACCCACAAGUCAAAUCACUCUAUCGCUCAUUGAUCCAAAAACUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUAUUCAAGAGUCCAUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACAUCCUGAUGGUGCAACCGCUAUCAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGUAAUCCAGGUCGGUUUCUAUCUAUUACGUAUUUCUCCCAGUACGAAAGGACAAGAGAAAUAAGGCCAACUUUAAAUCAAGCGCCUUAAGACAACCAAUGAUAACAUCUCAACUGACAACACAAAACCCUGCCCUAGAACAGGGC

Entity 2 Entity 2 polymer

Description description	Mitochondrial ribosomal protein L1
Molecular weight formula_weight	21224.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

LDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLL

Entity 3 Entity 3 polymer

Description description	mitochondrial ribosomal protein L2
Molecular weight formula_weight	14442.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

VIQVRYDPCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAG

Entity 4 Entity 4 polymer

Description description	Mitochondrial 39S ribosomal protein L3
Molecular weight formula_weight	23396.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

RVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPA

Entity 5 Entity 5 polymer

Description description	mitochondrial ribosomal protein L4 isoform a
Molecular weight formula_weight	19707.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

HQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLELPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPAVGLNVHSMLKHQTLVLTLPTVAFLED

Entity 6 Entity 6 polymer

Description description	39S ribosomal protein L12, mitochondrial
Molecular weight formula_weight	14831.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

PKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE

Entity 7 Entity 7 polymer

Description description	39S ribosomal protein L11, mitochondrial
Molecular weight formula_weight	15606.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

KPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK

Entity 8 Entity 8 polymer

Description description	39S ribosomal protein L13, mitochondrial
Molecular weight formula_weight	16958.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQP

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein L16
Molecular weight formula_weight	13107.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

DIRGPSTEATEFTEGNFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGAIDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAK

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein L17
Molecular weight formula_weight	13683.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

HGRVFRRMGLGPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYK

Entity 11 Entity 11 polymer

Description description	39S ribosomal protein L19, mitochondrial
Molecular weight formula_weight	11098.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

IPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYSTFDVNMK

Entity 12 Entity 12 polymer

Description description	MRPL20 protein
Molecular weight formula_weight	14125.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

LWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRH

Entity 13 Entity 13 polymer

Description description	mitochondrial ribosomal protein L22 isoform a
Molecular weight formula_weight	12914.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

HCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPP

Entity 14 Entity 14 polymer

Description description	mitochondrial ribosomal protein L24
Molecular weight formula_weight	11010.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

GDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRII

Entity 15 Entity 15 polymer

Description description	Mitochondrial 39S ribosomal protein L27
Molecular weight formula_weight	7520.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

ASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRY

Entity 16 Entity 16 polymer

Description description	mitochondrial ribosomal protein L33 isoform a
Molecular weight formula_weight	6092.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

AKSKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVEKK

Entity 17 Entity 17 polymer

Description description	39S ribosomal protein L34, mitochondrial
Molecular weight formula_weight	4485.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

YQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSL

▶

Resolution resolution	12.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	—

Structural Model for the Large Subunit of the Mammalian Mitochondrial Ribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

39S ribosomal protein L12, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ftc__assembly_1__model_1

2ftc__assembly_1__model_1 | I(q)

2ftc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer

7. Citations (1)