SAXSdb — 2g3v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAG pathogenicity island protein 13

Helicobacter pylori

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	(UNK)(UNK)(UNK)(UNK)(UNK)(MSE)(UNK) × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	(UNK)(UNK)(UNK)(UNK)(UNK)(MSE)(UNK) × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	(UNK)(UNK)(UNK)(UNK)(UNK)(MSE)(UNK) × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	(UNK)(UNK)(UNK)(UNK)(UNK)(MSE)(UNK) × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAGS_HELPY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–197； UniProt 3–196 Author chain B； PDBConstruct 4–197； UniProt 3–196 Author chain C； PDBConstruct 4–197； UniProt 3–196 Author chain D； PDBConstruct 4–197； UniProt 3–196

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2g3v
Deposition date deposition_date	2006-02-21
Structure title title	Crystal structure of CagS (HP0534, Cag13) from Helicobacter pylori
Keywords keywords	Helicobacter pylori, pathogenicity island, Type IV secretion system, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2g3v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2g3v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2g3v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.50 Å
Rg (electron density)	17.48 Å
Total Rg	18.23 Å
Atom count	1388
Residues	158
Excluded volume	25335 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2g3v__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2g3v__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2g3v__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2g3v__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	CAG pathogenicity island protein 13
Molecular weight formula_weight	25536.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	5790

MMGNNMRKLFSMIANSKDKKEKLIESLQENELLNTDEKKKIIDQIKTMHDFFKQMHTNKGALDKVLRNYMKDYRAVIKSIGVDKFKKVYRLLESETMELLHAIAENPNFLFSKFDRSILGIFLPFFSKPIMFKMSIREMDSQIELYGTKLPLLKLFVMTDEEMNFYANLKTIEQYNDYVRDLLMKFDLEKYMEEKGVQNALEHHHHHH

Source Source

Source organism organism	Helicobacter pylori
NCBI taxonomy ID ncbi_taxonomy_id	210
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	(UNK)(UNK)(UNK)(UNK)(UNK)(MSE)(UNK)
Molecular weight formula_weight	706.7 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

XXXXXMX

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	238

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2g3vA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1140 — CAG pathogenicity island protein 13, CagS

Domain ID domain_id	2g3vB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1140 — CAG pathogenicity island protein 13, CagS

Domain ID domain_id	2g3vC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1140 — CAG pathogenicity island protein 13, CagS

Domain ID domain_id	2g3vD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1140 — CAG pathogenicity island protein 13, CagS

▶

Unit-cell length a length_a	124.360 Å
Unit-cell length b length_b	124.360 Å
Unit-cell length c length_c	55.860 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	39.410 Å
R factor r_factor	0.2190
R_work r_work	0.2190
R_free r_free	0.2790

Crystal structure of CagS (HP0534, Cag13) from Helicobacter pylori

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAG pathogenicity island protein 13

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2g3v__assembly_1__model_1

2g3v__assembly_1__model_1 | I(q)

2g3v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)

Crystal structure of CagS (HP0534, Cag13) from Helicobacter pylori

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAG pathogenicity island protein 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2g3v__assembly_1__model_1

2g3v__assembly_1__model_1 | I(q)

2g3v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)