SAXSdb — 2gia

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

Trypanosoma brucei

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	mitochondrial RNA-binding protein 1 × 2 （P90629） ACETIC ACID × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q952G2_9TRYP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–195； UniProt 30–224 Author chain G； PDBConstruct 1–195； UniProt 30–224

mitochondrial RNA-binding protein 1

Trypanosoma brucei

UniProt P90629

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	mitochondrial RNA-binding protein 2 × 2 （Q952G2） ACETIC ACID × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P90629_9TRYP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–187； UniProt 20–206 Author chain D； PDBConstruct 1–187； UniProt 20–206

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2gia
Deposition date deposition_date	2006-03-28
Structure title title	Crystal structures of trypanosoma bruciei MRP1/MRP2
Keywords keywords	T. brucei; guide RNA; matchmaking; RNA editing, TRANSLATION; TRANSLATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2gia__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2gia__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2gia__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.82 Å
Rg (electron density)	27.42 Å
Total Rg	28.34 Å
Atom count	4941
Residues	601
Excluded volume	87034 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2gia__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	mitochondrial RNA-binding protein 2
Molecular weight formula_weight	21914.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G
Atom count atom_count	5509

EAASSSDADGKEVGSSGEGNRATGGKWRRPSLAQQRARRAQLPPAFDVVHWNDEDISRGHLLRVLHRDTFVVLDYHRQARMLTEEGNKAERVVSVMLPAVYTARFLAVLEGRSEKVEVHSRYTNATFTPNPAAPYTFTLKCTSTRPAQQKQQVAGEEGDETFEWTVEFDVAESLMLQRFLTQALHYNTGFARTSV

Source Source

Source organism organism	Trypanosoma brucei
NCBI taxonomy ID ncbi_taxonomy_id	185431
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	mitochondrial RNA-binding protein 1
Molecular weight formula_weight	21192.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

ASTFSGVQSLPKFEIHDVRDDPAEGTMTRVAVDGKLLLISQYPQLGPRKVDPNDLSPQFDADRRISVRLRHVDLAYLVGVCKERVPRHRMETKAYTLDFEKSAQGYHLHGKVHRVASQRMEDWSVKFDNHFAVTLEHFLESALDESFGFRQHYATRAAEGGEKIAATSSAEGGARRKRSVSDTSRYH

Source Source

Source organism organism	Trypanosoma brucei
NCBI taxonomy ID ncbi_taxonomy_id	185431
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	ACETIC ACID
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	568

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2giaa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.4 — Guide RNA binding protein gBP

Domain ID domain_id	d2giab1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.4 — Guide RNA binding protein gBP

Domain ID domain_id	d2giad_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.4 — Guide RNA binding protein gBP

Domain ID domain_id	d2giag_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.4 — Guide RNA binding protein gBP

CATH v4.4 (4 domains)

Domain ID domain_id	2giaA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2giaB00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2giaD00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2giaG00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	60.270 Å
Unit-cell length b length_b	85.700 Å
Unit-cell length c length_c	86.860 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.38 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.890 Å
Low-resolution limit resolution_low	47.380 Å
R factor r_factor	0.1791
R_work r_work	0.1790
R_free r_free	0.2160

Crystal structures of trypanosoma bruciei MRP1/MRP2

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

State in the Current Structure

Other States of the Same Protein in the Database

mitochondrial RNA-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gia__assembly_1__model_1

2gia__assembly_1__model_1 | I(q)

2gia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structures of trypanosoma bruciei MRP1/MRP2

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

mitochondrial RNA-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gia__assembly_1__model_1

2gia__assembly_1__model_1 | I(q)

2gia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)