SAXSdb — 2gje

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

Trypanosoma brucei

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 2 RNA 2	guide RNA 40-mer × 1 RNA tetramer × 1 mitochondrial RNA-binding protein 1 × 1 （P90629） water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q952G2_9TRYP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–195； UniProt 30–224

mitochondrial RNA-binding protein 1

Trypanosoma brucei

UniProt P90629

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 2 RNA 2	guide RNA 40-mer × 1 RNA tetramer × 1 mitochondrial RNA-binding protein 2 × 1 （Q952G2） water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P90629_9TRYP
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–187； UniProt 20–206

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2gje
Deposition date deposition_date	2006-03-30
Structure title title	Structure of a guideRNA-binding protein complex bound to a gRNA
Keywords keywords	guide RNA; kRNA editing; RNA binding protein, TRANSLATION-RNA COMPLEX; TRANSLATION/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2gje__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2gje__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2gje__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.87 Å
Rg (electron density)	22.65 Å
Total Rg	23.41 Å
Atom count	2768
Residues	304
Excluded volume	47563 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2gje__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	guide RNA 40-mer
Molecular weight formula_weight	12534.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R
Atom count atom_count	2769

AAAUACGAUGUAAAUAACCUGUAGUAUAGUUAGUGUAUA

Entity 2 Entity 2 polymer

Description description	RNA tetramer
Molecular weight formula_weight	1587.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	S

UAGUG

Entity 3 Entity 3 polymer

Description description	mitochondrial RNA-binding protein 2
Molecular weight formula_weight	22055.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

EAASSSDADGKEVGSSGEGNRATGGKWRRPSLAQQRARRAQLPPAFDVVHWNDEDISRGHLLRVLHRDTFVVLDYHRQARMLTEEGNKAERVVSVMLPAVYTARFLAVLEGRSEKVEVHSRYTNATFTPNPAAPYTFTLKCTSTRPAQQKQQVAGEEGDETFEWTVEFDVAESLMLQRFLTQALHYNTGFARTSV

Source Source

Source organism organism	Trypanosoma brucei
NCBI taxonomy ID ncbi_taxonomy_id	185431
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	mitochondrial RNA-binding protein 1
Molecular weight formula_weight	21333.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ASTFSGVQSLPKFEIHDVRDDPAEGTMTRVAVDGKLLLISQYPQLGPRKVDPNDLSPQFDADRRISVRLRHVDLAYLVGVCKERVPRHRMETKAYTLDFEKSAQGYHLHGKVHRVASQRMEDWSVKFDNHFAVTLEHFLESALDESFGFRQHYATRAAEGGEKIAATSSAEGGARRKRSVSDTSRYH

Source Source

Source organism organism	Trypanosoma brucei
NCBI taxonomy ID ncbi_taxonomy_id	185431
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2gjed1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.4 — Guide RNA binding protein gBP

CATH v4.4 (2 domains)

Domain ID domain_id	2gjeA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2gjeD00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	157.600 Å
Unit-cell length b length_b	157.600 Å
Unit-cell length c length_c	81.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 61 2 2
Space-group number int_tables_number	178
Crystal system crystal_system	—

Resolution resolution	3.370 Å
Low-resolution limit resolution_low	69.850 Å
R factor r_factor	0.2821
R_work r_work	0.2820
R_free r_free	0.3000

Structure of a guideRNA-binding protein complex bound to a gRNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

State in the Current Structure

Other States of the Same Protein in the Database

mitochondrial RNA-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gje__assembly_1__model_1

2gje__assembly_1__model_1 | I(q)

2gje__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Structure of a guideRNA-binding protein complex bound to a gRNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

mitochondrial RNA-binding protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

mitochondrial RNA-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gje__assembly_1__model_1

2gje__assembly_1__model_1 | I(q)

2gje__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)