SAXSdb — 2gvm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hydrophobin-1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	ZINC ION × 4 LAURYL DIMETHYLAMINE-N-OXIDE × 20 water × 8	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 8	ZINC ION × 4 LAURYL DIMETHYLAMINE-N-OXIDE × 20 water × 8	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 8	ZINC ION × 4 LAURYL DIMETHYLAMINE-N-OXIDE × 20 water × 8	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ZINC ION × 1 LAURYL DIMETHYLAMINE-N-OXIDE × 2 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	ZINC ION × 1 LAURYL DIMETHYLAMINE-N-OXIDE × 6 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	LAURYL DIMETHYLAMINE-N-OXIDE × 2 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HYP1_TRIRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–75； UniProt 23–97 Author chain B； PDBConstruct 1–75； UniProt 23–97 Author chain C； PDBConstruct 1–75； UniProt 23–97 Author chain D； PDBConstruct 1–75； UniProt 23–97

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2gvm
Deposition date deposition_date	2006-05-03
Structure title title	Crystal structure of hydrophobin HFBI with detergent
Keywords keywords	hydrophobin, amphiphile, surfactant, high solvent content, SURFACE ACTIVE PROTEIN; SURFACE ACTIVE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2gvm__assembly_6__model_1

Assembly 6 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2gvm__assembly_6__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2gvm__assembly_6__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	11.61 Å
Rg (electron density)	11.25 Å
Total Rg	12.72 Å
Atom count	524
Residues	70
Excluded volume	9588 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2gvm__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2gvm__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2gvm__assembly_3__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2gvm__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2gvm__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2gvm__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2gvm__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Hydrophobin-1
Molecular weight formula_weight	7543.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2248

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	LAURYL DIMETHYLAMINE-N-OXIDE
Molecular weight formula_weight	229.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	118

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2gvma_
Class class	b — All beta proteins
Fold Fold fold	b.138 — Hydrophobin II, HfbII
Superfamily Superfamily superfamily	b.138.1 — Hydrophobin II, HfbII
Family Family family	b.138.1.1 — Hydrophobin II, HfbII

Domain ID domain_id	d2gvmb_
Class class	b — All beta proteins
Fold Fold fold	b.138 — Hydrophobin II, HfbII
Superfamily Superfamily superfamily	b.138.1 — Hydrophobin II, HfbII
Family Family family	b.138.1.1 — Hydrophobin II, HfbII

Domain ID domain_id	d2gvmc_
Class class	b — All beta proteins
Fold Fold fold	b.138 — Hydrophobin II, HfbII
Superfamily Superfamily superfamily	b.138.1 — Hydrophobin II, HfbII
Family Family family	b.138.1.1 — Hydrophobin II, HfbII

Domain ID domain_id	d2gvmd_
Class class	b — All beta proteins
Fold Fold fold	b.138 — Hydrophobin II, HfbII
Superfamily Superfamily superfamily	b.138.1 — Hydrophobin II, HfbII
Family Family family	b.138.1.1 — Hydrophobin II, HfbII

CATH v4.4 (4 domains)

Domain ID domain_id	2gvmA00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	120 — hfbii hydrophobin
Homologous superfamily homologous superfamily	10 — Hydrophobin

Domain ID domain_id	2gvmB00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	120 — hfbii hydrophobin
Homologous superfamily homologous superfamily	10 — Hydrophobin

Domain ID domain_id	2gvmC00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	120 — hfbii hydrophobin
Homologous superfamily homologous superfamily	10 — Hydrophobin

Domain ID domain_id	2gvmD00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	120 — hfbii hydrophobin
Homologous superfamily homologous superfamily	10 — Hydrophobin

▶

Unit-cell length a length_a	91.900 Å
Unit-cell length b length_b	121.600 Å
Unit-cell length c length_c	121.200 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2330
R_work r_work	0.2330
R_free r_free	0.2470

Crystal structure of hydrophobin HFBI with detergent

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hydrophobin-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gvm__assembly_6__model_1

2gvm__assembly_6__model_1 | I(q)

2gvm__assembly_6__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of hydrophobin HFBI with detergent

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hydrophobin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gvm__assembly_6__model_1

2gvm__assembly_6__model_1 | I(q)

2gvm__assembly_6__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)