SAXSdb — 2gx9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NS1 Effector Domain

unidentified influenza virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	THIOCYANATE ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q71QT3_IAPUE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–129； UniProt 80–208 Author chain B； PDBConstruct 1–129； UniProt 80–208

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2gx9
Deposition date deposition_date	2006-05-08
Structure title title	X-ray structure of influenza virus NS1 effector domain
Keywords keywords	NS1, Influenza, Effector Domain, alpha-helix beta-crescent, TRANSCRIPTION, VIRUS-VIRAL PROTEIN COMPLEX; TRANSCRIPTION, VIRUS/VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2gx9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2gx9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2gx9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.20 Å
Rg (electron density)	20.22 Å
Total Rg	21.19 Å
Atom count	1959
Residues	237
Excluded volume	35336 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2gx9__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	NS1 Effector Domain
Molecular weight formula_weight	14736.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2229

MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSN

Source Source

Source organism organism	unidentified influenza virus
NCBI taxonomy ID ncbi_taxonomy_id	11309
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	THIOCYANATE ION
Molecular weight formula_weight	58.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	270

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2gx9a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

Domain ID domain_id	d2gx9b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

CATH v4.4 (2 domains)

Domain ID domain_id	2gx9A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

Domain ID domain_id	2gx9B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

▶

Unit-cell length a length_a	59.000 Å
Unit-cell length b length_b	59.000 Å
Unit-cell length c length_c	268.022 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43 2 2
Space-group number int_tables_number	95
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2070
R_work r_work	0.2060
R_free r_free	0.2230

X-ray structure of influenza virus NS1 effector domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

NS1 Effector Domain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gx9__assembly_1__model_1

2gx9__assembly_1__model_1 | I(q)

2gx9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

X-ray structure of influenza virus NS1 effector domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

NS1 Effector Domain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gx9__assembly_1__model_1

2gx9__assembly_1__model_1 | I(q)

2gx9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)