SAXSdb — 2hil

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Homooligomer	Protein 18 其他Polymer 18	alpha-D-galactopyranose-(1-3)-2,4-bisacetamido-2,4-dideoxy-beta-D-glucopyranose × 18 PHOSPHORIC ACID MONO-(2-AMINO-ETHYL) ESTER × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FMM1_NEIGO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–158； UniProt 8–165 Author chain B； PDBConstruct 1–158； UniProt 8–165 Author chain C； PDBConstruct 1–158； UniProt 8–165 Author chain D； PDBConstruct 1–158； UniProt 8–165 Author chain E； PDBConstruct 1–158； UniProt 8–165 Author chain F； PDBConstruct 1–158； UniProt 8–165 Author chain G； PDBConstruct 1–158； UniProt 8–165 Author chain H； PDBConstruct 1–158； UniProt 8–165 Author chain I； PDBConstruct 1–158； UniProt 8–165 Author chain J； PDBConstruct 1–158； UniProt 8–165 Author chain K； PDBConstruct 1–158； UniProt 8–165 Author chain L； PDBConstruct 1–158； UniProt 8–165 Author chain M； PDBConstruct 1–158； UniProt 8–165 Author chain N； PDBConstruct 1–158； UniProt 8–165 Author chain O； PDBConstruct 1–158； UniProt 8–165 Author chain P； PDBConstruct 1–158； UniProt 8–165 Author chain Q； PDBConstruct 1–158； UniProt 8–165 Author chain R； PDBConstruct 1–158； UniProt 8–165

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hil
Deposition date deposition_date	2006-06-29
Structure title title	Structure of the Neisseria gonorrhoeae Type IV pilus filament from x-ray crystallography and electron cryomicroscopy
Keywords keywords	TYPE IV PILI, virulence factors, DNA binding protein, natural transformation, antigenic variation, CELL ADHESION; CELL ADHESION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2hil__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2hil__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2hil__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.28 Å
Rg (electron density)	61.09 Å
Total Rg	60.87 Å
Atom count	22374
Residues	2826
Excluded volume	398470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2hil__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fimbrial protein
Molecular weight formula_weight	17210.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R
Atom count atom_count	22374

FTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWPENNTSAGVASSPTDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK

Entity 2 Entity 2 branched

Description description	alpha-D-galactopyranose-(1-3)-2,4-bisacetamido-2,4-dideoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	18

Entity 3 Entity 3 non-polymer

Description description	PHOSPHORIC ACID MONO-(2-AMINO-ETHYL) ESTER
Molecular weight formula_weight	141.1 kDa
Source method src_method	syn
Copy count entity_count	18

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	12.500 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	12.50 Å
Resolution测定Method resolution_method	IHRSR
颗粒数 num_particles	25000

Structure of the Neisseria gonorrhoeae Type IV pilus filament from x-ray crystallography and electron cryomicroscopy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hil__assembly_1__model_1

2hil__assembly_1__model_1 | I(q)

2hil__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 branched

Entity 3 Entity 3 non-polymer

7. Citations (1)

Structure of the Neisseria gonorrhoeae Type IV pilus filament from x-ray crystallography and electron cryomicroscopy

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fimbrial protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hil__assembly_1__model_1

2hil__assembly_1__model_1 | I(q)

2hil__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 branched

Entity 3 Entity 3 non-polymer

7. Citations (1)