SAXSdb — 2hnu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Oxytocin-neurophysin 1

Bos taurus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PHENYLALANINE × 2 TYROSINE × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	PHENYLALANINE × 2 TYROSINE × 2 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	PHENYLALANINE × 2 TYROSINE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEU1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–81； UniProt 38–118 Author chain B； PDBConstruct 1–81； UniProt 38–118 Author chain C； PDBConstruct 1–81； UniProt 38–118 Author chain D； PDBConstruct 1–81； UniProt 38–118 Author chain E； PDBConstruct 1–81； UniProt 38–118

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hnu
Deposition date deposition_date	2006-07-13
Structure title title	Crystal Structure of a Dipeptide Complex of Bovine Neurophysin-I
Keywords keywords	;Neurophysin, ligand-facilitated dimerization, inter-domain loop, amino-terminus, subunit interface, hydrogen bonding, PEPTIDE BINDING PROTEIN ;; PEPTIDE BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2hnu__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2hnu__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2hnu__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.74 Å
Rg (electron density)	15.31 Å
Total Rg	16.06 Å
Atom count	1164
Residues	162
Excluded volume	20210 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2hnu__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2hnu__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2hnu__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Oxytocin-neurophysin 1
Molecular weight formula_weight	8163.3 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	2982

VRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDP

Source Source

Source organism organism	Bos taurus
Common name common_name	cattle
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PHENYLALANINE
Molecular weight formula_weight	165.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	TYROSINE
Molecular weight formula_weight	181.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	72

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d2hnua_
Class class	b — All beta proteins
Fold Fold fold	b.9 — Neurophysin II
Superfamily Superfamily superfamily	b.9.1 — Neurophysin II
Family Family family	b.9.1.1 — Neurophysin II

Domain ID domain_id	d2hnub_
Class class	b — All beta proteins
Fold Fold fold	b.9 — Neurophysin II
Superfamily Superfamily superfamily	b.9.1 — Neurophysin II
Family Family family	b.9.1.1 — Neurophysin II

Domain ID domain_id	d2hnuc_
Class class	b — All beta proteins
Fold Fold fold	b.9 — Neurophysin II
Superfamily Superfamily superfamily	b.9.1 — Neurophysin II
Family Family family	b.9.1.1 — Neurophysin II

Domain ID domain_id	d2hnud_
Class class	b — All beta proteins
Fold Fold fold	b.9 — Neurophysin II
Superfamily Superfamily superfamily	b.9.1 — Neurophysin II
Family Family family	b.9.1.1 — Neurophysin II

Domain ID domain_id	d2hnue_
Class class	b — All beta proteins
Fold Fold fold	b.9 — Neurophysin II
Superfamily Superfamily superfamily	b.9.1 — Neurophysin II
Family Family family	b.9.1.1 — Neurophysin II

CATH v4.4 (5 domains)

Domain ID domain_id	2hnuA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	9 — Neurophysin II; Chain A
Homologous superfamily homologous superfamily	10 — Neurohypophysial hormone domain

Domain ID domain_id	2hnuB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	9 — Neurophysin II; Chain A
Homologous superfamily homologous superfamily	10 — Neurohypophysial hormone domain

Domain ID domain_id	2hnuC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	9 — Neurophysin II; Chain A
Homologous superfamily homologous superfamily	10 — Neurohypophysial hormone domain

Domain ID domain_id	2hnuD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	9 — Neurophysin II; Chain A
Homologous superfamily homologous superfamily	10 — Neurohypophysial hormone domain

Domain ID domain_id	2hnuE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	9 — Neurophysin II; Chain A
Homologous superfamily homologous superfamily	10 — Neurohypophysial hormone domain

▶

Unit-cell length a length_a	111.157 Å
Unit-cell length b length_b	111.157 Å
Unit-cell length c length_c	127.241 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	60

Space group space_group	P 62 2 2
Space-group number int_tables_number	180
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	28.650 Å
R factor r_factor	—
R_work r_work	0.2190
R_free r_free	0.2450

Crystal Structure of a Dipeptide Complex of Bovine Neurophysin-I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Oxytocin-neurophysin 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hnu__assembly_3__model_1

2hnu__assembly_3__model_1 | I(q)

2hnu__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

CATH v4.4 (5 domains)

7. Citations (1)

Crystal Structure of a Dipeptide Complex of Bovine Neurophysin-I

1. Protein Identity and Related Structures Protein Identity & Related Structures

Oxytocin-neurophysin 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hnu__assembly_3__model_1

2hnu__assembly_3__model_1 | I(q)

2hnu__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

CATH v4.4 (5 domains)

7. Citations (1)