SAXSdb — 2i9z

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

Staphylococcus epidermidis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SP5G_STAES
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–105； UniProt 1–102 Author chain B； PDBConstruct 4–105； UniProt 1–102

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2i9z
Deposition date deposition_date	2006-09-06
Structure title title	Structural Genomics, the Crystal structure of full-length SpoVG from Staphylococcus epidermidis ATCC 12228
Keywords keywords	;APC86317, SpoVG, Staphylococcus epidermidis ATCC 12228, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2i9z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2i9z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2i9z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.32 Å
Rg (electron density)	17.17 Å
Total Rg	17.92 Å
Atom count	1376
Residues	161
Excluded volume	24667 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2i9z__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Putative septation protein spoVG
Molecular weight formula_weight	12042.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1451

SNAMKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVIPDKNATSDNEESDEA

Source Source

Source organism organism	Staphylococcus epidermidis
NCBI taxonomy ID ncbi_taxonomy_id	176280
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	75

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2i9za1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2i9zb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

CATH v4.4 (2 domains)

Domain ID domain_id	2i9zA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2i9zB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

▶

Unit-cell length a length_a	63.604 Å
Unit-cell length b length_b	63.604 Å
Unit-cell length c length_c	98.498 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	44.990 Å
R factor r_factor	0.2253
R_work r_work	0.2232
R_free r_free	0.2641

Structural Genomics, the Crystal structure of full-length SpoVG from Staphylococcus epidermidis ATCC 12228

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2i9z__assembly_1__model_1

2i9z__assembly_1__model_1 | I(q)

2i9z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Structural Genomics, the Crystal structure of full-length SpoVG from Staphylococcus epidermidis ATCC 12228

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2i9z__assembly_1__model_1

2i9z__assembly_1__model_1 | I(q)

2i9z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)