2ia9

Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 DI(HYDROXYETHYL)ETHER × 4 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	DI(HYDROXYETHYL)ETHER × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SP5G_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–100； UniProt 1–97 Author chain B； PDBConstruct 4–100； UniProt 1–97 Author chain C； PDBConstruct 4–100； UniProt 1–97 Author chain D； PDBConstruct 4–100； UniProt 1–97 Author chain E； PDBConstruct 4–100； UniProt 1–97 Author chain F； PDBConstruct 4–100； UniProt 1–97

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ia9
Deposition date deposition_date	2006-09-07
Structure title title	Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
Keywords keywords	;APC85465, SpoVG, Bacillus subtilis subsp. subtilis str. 168, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ia9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ia9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ia9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.13 Å
Rg (electron density)	19.42 Å
Total Rg	19.94 Å
Atom count	1543
Residues	183
Excluded volume	27039 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ia9__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2ia9__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2ia9__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Putative septation protein spoVG
Molecular weight formula_weight	11322.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	4499

SNAMEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFEEAGAS

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	98

▼

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d2ia9a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ia9b2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9b3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ia9c2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9c3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ia9d2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9d3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ia9e2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9e3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ia9f2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.366 — SpoVG-like
Superfamily Superfamily superfamily	d.366.1 — SpoVG-like
Family Family family	d.366.1.1 — SpoVG-like

Domain ID domain_id	d2ia9f3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (6 domains)

Domain ID domain_id	2ia9A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2ia9B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2ia9C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2ia9D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2ia9E00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

Domain ID domain_id	2ia9F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	40 — Stage V sporulation protein G

▶

Unit-cell length a length_a	136.464 Å
Unit-cell length b length_b	136.464 Å
Unit-cell length c length_c	110.493 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	47.950 Å
R factor r_factor	0.2301
R_work r_work	0.2267
R_free r_free	0.2960

Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ia9__assembly_1__model_1

2ia9__assembly_1__model_1 | I(q)

2ia9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative septation protein spoVG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ia9__assembly_1__model_1

2ia9__assembly_1__model_1 | I(q)

2ia9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 18 domains

SCOP 2.08 (12 domains)

CATH v4.4 (6 domains)

7. Citations (1)