SAXSdb — 2ii1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetamidase

Bacillus halodurans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CALCIUM ION × 5 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	CALCIUM ION × 10 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KGN3_BACHD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–301； UniProt 1–300 Author chain B； PDBConstruct 1–301； UniProt 1–300 Author chain C； PDBConstruct 1–301； UniProt 1–300 Author chain D； PDBConstruct 1–301； UniProt 1–300

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ii1
Deposition date deposition_date	2006-09-27
Structure title title	Crystal structure of Acetamidase (10172637) from Bacillus Halodurans at 1.95 A resolution
Keywords keywords	;10172637, ACETAMIDASE, STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, PSI-2, Protein Structure Initiative, JCSG, Hydrolase ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ii1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ii1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ii1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.86 Å
Rg (electron density)	24.93 Å
Total Rg	25.60 Å
Atom count	4384
Residues	574
Excluded volume	79140 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ii1__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2ii1__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Acetamidase
Molecular weight formula_weight	32416.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9233

GMIRLSNENTIFFMDKENVPIASCQSGDTVIFETKDCFSDQITNEEQALTSIDFNRVNPATGPLYVEGARRGDMLEIEILDIKVGKQGVMTAAPGLGALGESLNSPTTKLFPIEGDDVVYSTGLRLPLQPMIGVIGTAPPGEPINNGTPGPHGGNLDTKDIKPGTTVYLPVEVDGALLALGDLHAAMGDGEILICGVEIAGTVTLKVNVKKERMFPLPALKTDTHFMTIASAETLDAAAVQATKNMATFLANRTALSIEEAGMLLSGAGDLYVSQIVNPLKTARFSLALHYFEKLGVDLCN

Source Source

Source organism organism	Bacillus halodurans
NCBI taxonomy ID ncbi_taxonomy_id	86665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	443

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d2ii1a1
Class class	b — All beta proteins
Fold Fold fold	b.23 — CUB-like
Superfamily Superfamily superfamily	b.23.3 — Acetamidase/Formamidase-like
Family Family family	b.23.3.0 — automated matches

Domain ID domain_id	d2ii1a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ii1b_
Class class	b — All beta proteins
Fold Fold fold	b.23 — CUB-like
Superfamily Superfamily superfamily	b.23.3 — Acetamidase/Formamidase-like
Family Family family	b.23.3.0 — automated matches

Domain ID domain_id	d2ii1c_
Class class	b — All beta proteins
Fold Fold fold	b.23 — CUB-like
Superfamily Superfamily superfamily	b.23.3 — Acetamidase/Formamidase-like
Family Family family	b.23.3.0 — automated matches

Domain ID domain_id	d2ii1d_
Class class	b — All beta proteins
Fold Fold fold	b.23 — CUB-like
Superfamily Superfamily superfamily	b.23.3 — Acetamidase/Formamidase-like
Family Family family	b.23.3.0 — automated matches

▶

Unit-cell length a length_a	43.759 Å
Unit-cell length b length_b	69.605 Å
Unit-cell length c length_c	94.984 Å
Unit-cell angle α angle_alpha	73.95 °
Unit-cell angle β angle_beta	88.91 °
Unit-cell angle γ angle_gamma	86.63 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	28.890 Å
R factor r_factor	0.1776
R_work r_work	0.1750
R_free r_free	0.2280

Crystal structure of Acetamidase (10172637) from Bacillus Halodurans at 1.95 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetamidase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ii1__assembly_1__model_1

2ii1__assembly_1__model_1 | I(q)

2ii1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (5 domains)

7. Citations (1)

Crystal structure of Acetamidase (10172637) from Bacillus Halodurans at 1.95 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetamidase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ii1__assembly_1__model_1

2ii1__assembly_1__model_1 | I(q)

2ii1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (5 domains)

7. Citations (1)