2inn

Structure of the Phenol Hydroxyalse-Regulatory Protein Complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phenol hydroxylase component phN

Pseudomonas stutzeri

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phO × 2 （Q84AQ1） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 MOLYBDATE ION × 1 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ2_PSEST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–511； UniProt 1–511 Author chain B； PDBConstruct 1–511； UniProt 1–511

Phenol hydroxylase component phL

Pseudomonas stutzeri

UniProt Q84AQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phO × 2 （Q84AQ1） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 MOLYBDATE ION × 1 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ4_PSEST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–333； UniProt 1–333 Author chain D； PDBConstruct 1–333； UniProt 1–333

Phenol hydroxylase component phO

Pseudomonas stutzeri

UniProt Q84AQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 MOLYBDATE ION × 1 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ1_PSEST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–119； UniProt 1–119 Author chain F； PDBConstruct 1–119； UniProt 1–119

Phenol hydroxylase component phM

Pseudomonas stutzeri

UniProt Q84AQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phO × 2 （Q84AQ1） FE (III) ION × 4 ZINC ION × 2 MOLYBDATE ION × 1 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ3_PSEST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–89； UniProt 1–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2inn
Deposition date deposition_date	2006-10-08
Structure title title	Structure of the Phenol Hydroxyalse-Regulatory Protein Complex
Keywords keywords	hydroxylase, four-helix bundle, diiron, phenol, complex, Oxidoreductase; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2inn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2inn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2inn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.71 Å
Rg (electron density)	40.50 Å
Total Rg	40.66 Å
Atom count	16055
Residues	1879
Excluded volume	284690 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2inn__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Phenol hydroxylase component phN
Molecular weight formula_weight	61058.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	16389

MVSKNKKLNLKDKYQYLTRDMAWEPTYQDKKDIFPEEDFEGIKITDWSQWEDPFRLTMDAYWKYQAEKEKKLYAIFDAFAQNNGHQNISDARYVNALKLFISGISPLEHAAFQGYSKVGRQFSGAGARVACQMQAIDELRHSQTQQHAMSHYNKHFNGLHDGPHMHDRVWYLSVPKSFFDDARSAGPFEFLTAISFSFEYVLTNLLFVPFMSGAAYNGDMATVTFGFSAQSDEARHMTLGLEVIKFILEQHEDNVPIVQRWIDKWFWRGFRLLSLVSMMMDYMLPNKVMSWSEAWEVYYEQNGGALFKDLERYGIRPPKYQDVANDAKHHLSHQLWTTFYQYCQATNFHTWIPEKEEMDWMSEKYPDTFDKYYRPRYEYLAKEAAAGRRFYNNTLPQLCQVCQIPTIFTEKDAPTMLSHRQIEHEGERYHFCSDGCCDIFKHEPEKYIQAWLPVHQIYQGNCEGGDLETVVQKYYHINIGEDNFDYVGSPDQKHWLSIKGRKPADKNQDDA

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phenol hydroxylase component phL
Molecular weight formula_weight	39255.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MSIEIKTNSVEPIRHTYGHIARRFGDKPATRYQEASYDIEAKTNFHYRPQWDSEHTLNDPTRTAIRMEDWCAVSDPRQFYYGAYVGNRAKMQESAETSFGFCEKRNLLTRLSEETQKQLLRLLVPLRHVELGANMNNAKIAGDATATTVSQMHIYTGMDRLGIGQYLSRIALMIDGSTGAALDESKAYWMDDEMWQPMRKLVEDTLVVDDWFELTLVQNILIDGMMYPLVYDKMDQWFESQGAEDVSMLTEFMRDWYKESLRWTNAMMKAVAGESETNRELLQKWIDHWEPQAYEALKPLAEASVGIDGLNEARAELSARLKKFELQSRGVSA

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Phenol hydroxylase component phO
Molecular weight formula_weight	13482.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MSVNALYDYKFEPKDKVENFHGMQLLYVYWPDHLLFCAPFALLVQPGMTFSALVDEILKPATAAHPDSAKADFLNAEWLLNDEPFTPKADASLKEQGIDHKSMLTVTTPGLKGMANAGY

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Phenol hydroxylase component phM
Molecular weight formula_weight	10770.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSQLVFIVFQDNDDSRYLAEAVMEDNPDAEMQHQPAMIRIQAEKRLVINRETMEEKLGRDWDVQEMLINVISIAGNVDEDDDHFILEWN

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MOLYBDATE ION
Molecular weight formula_weight	159.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	304

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2innl_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

CATH v4.4 (7 domains)

Domain ID domain_id	2innA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2innB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2innC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2innD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2innE01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	560 — Phenol hydroxylase

Domain ID domain_id	2innF01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	560 — Phenol hydroxylase

Domain ID domain_id	2innL00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

▶

Unit-cell length a length_a	87.453 Å
Unit-cell length b length_b	146.925 Å
Unit-cell length c length_c	189.787 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2060
R_work r_work	0.2020
R_free r_free	0.2520

Structure of the Phenol Hydroxyalse-Regulatory Protein Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phenol hydroxylase component phN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phL

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phO

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phM

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2inn__assembly_1__model_1

2inn__assembly_1__model_1 | I(q)

2inn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (1 domains)

CATH v4.4 (7 domains)

7. Citations (1)