SAXSdb — 2inp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phenol hydroxylase component phN

Pseudomonas stutzeri

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phO × 2 （Q84AQ1） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ2_PSEST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–494； UniProt 6–499 Author chain B； PDBConstruct 1–494； UniProt 6–499

Phenol hydroxylase component phL

Pseudomonas stutzeri

UniProt Q84AQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phO × 2 （Q84AQ1） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ4_PSEST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–328； UniProt 4–331 Author chain D； PDBConstruct 1–328； UniProt 4–331

Phenol hydroxylase component phO

Pseudomonas stutzeri

UniProt Q84AQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phM × 1 （Q84AQ3） FE (III) ION × 4 ZINC ION × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ1_PSEST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–118； UniProt 2–119 Author chain F； PDBConstruct 1–118； UniProt 2–119

Phenol hydroxylase component phM

Pseudomonas stutzeri

UniProt Q84AQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Phenol hydroxylase component phN × 2 （Q84AQ2） Phenol hydroxylase component phL × 2 （Q84AQ4） Phenol hydroxylase component phO × 2 （Q84AQ1） FE (III) ION × 4 ZINC ION × 2 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84AQ3_PSEST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–89； UniProt 1–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2inp
Deposition date deposition_date	2006-10-08
Structure title title	Structure of the Phenol Hydroxylase-Regulatory Protein Complex
Keywords keywords	hydroxylase, diiron, four-helix bundle, regulatory protein, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2inp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2inp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2inp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.92 Å
Rg (electron density)	40.61 Å
Total Rg	40.92 Å
Atom count	15957
Residues	1952
Excluded volume	281860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2inp__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Phenol hydroxylase component phN
Molecular weight formula_weight	58401.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	17022

KKLNLKDKYQYLTRDMAWEPTYQDKKDIFPEEDFEGIKITDWSQWEDPFRLTMDAYWKYQAEKEKKLYAIFDAFAQNNGHQNISDARYVNALKLFISGISPLEHAAFQGYSKVGRQFSGAGARVACQMQAIDELRHSQTQQHAMSHYNKHFNGLHDGPHMHDRVWYLSVPKSFFDDARSAGPFEFLTAISFSFEYVLTNLLFVPFMSGAAYNGDMATVTFGFSAQSDEARHMTLGLEVIKFILEQHEDNVPIVQRWIDKWFWRGFRLLSLVSMMMDYMLPNKVMSWSEAWEVYYEQNGGALFKDLERYGIRPPKYQDVANDAKHHLSHQLWTTFYQYCQATNFHTWIPEKEEMDWMSEKYPDTFDKYYRPRYEYLAKEAAAGRRFYNNTLPQLCQVCQIPTIFTEKDAPTMLSHRQIEHEGERYHFCSDGCCDIFKHEPEKYIQAWLPVHQIYQGNCEGGDLETVVQKYYHINIGEDNFDYVGSPDQKHWLSIK

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phenol hydroxylase component phL
Molecular weight formula_weight	37968.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

EIKTNSVEPIRHTYGHIARRFGDKPATRYQEASYDIEAKTNFHYRPQWDSEHTLNDPTRTAIRMEDWCAVSDPRQFYYGAYVGNRAKMQESAETSFGFCEKRNLLTRLSEETQKQLLRLLVPLRHVELGANMNNAKIAGDATATTVSQMHIYTGMDRLGIGQYLSRIALMIDGSTGAALDESKAYWMDDEMWQPMRKLVEDTLVVDDWFELTLVQNILIDGMMYPLVYDKMDQWFESQGAEDVSMLTEFMRDWYKESLRWTNAMMKAVAGESETNRELLQKWIDHWEPQAYEALKPLAEASVGIDGLNEARAELSARLKKFELQSRGV

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Phenol hydroxylase component phO
Molecular weight formula_weight	13116.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

SVNALYDYKFEPKDKVENFHGMQLLYVYWPDHLLFCAPFALLVQPGMTFSALVDEILKPATAAHPDSAKADFLNAEWLLNDEPFTPKADASLKEQGIDHKSMLTVTTPGLKGMANAGY

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Phenol hydroxylase component phM
Molecular weight formula_weight	10488.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSQLVFIVFQDNDDSRYLAEAVMEDNPDAEMQHQPAMIRIQAEKRLVINRETMEEKLGRDWDVQEMLINVISIAGNVDEDDDHFILEWN

Source Source

Source organism organism	Pseudomonas stutzeri
NCBI taxonomy ID ncbi_taxonomy_id	316
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1022

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2inpl_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

CATH v4.4 (7 domains)

Domain ID domain_id	2inpA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2inpB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2inpC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2inpD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	2inpE01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	560 — Phenol hydroxylase

Domain ID domain_id	2inpF01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	560 — Phenol hydroxylase

Domain ID domain_id	2inpL00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

▶

Unit-cell length a length_a	87.751 Å
Unit-cell length b length_b	146.305 Å
Unit-cell length c length_c	190.020 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1980
R_work r_work	0.1920
R_free r_free	0.2360

Structure of the Phenol Hydroxylase-Regulatory Protein Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phenol hydroxylase component phN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phL

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phO

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phenol hydroxylase component phM

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2inp__assembly_1__model_1

2inp__assembly_1__model_1 | I(q)

2inp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (1 domains)

CATH v4.4 (7 domains)

7. Citations (1)