SAXSdb — 2iw0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHITIN DEACETYLASE

COLLETOTRICHUM LINDEMUTHIANUM

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ZINC ION × 1 ACETATE ION × 3 CHLORIDE ION × 1 PHOSPHATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6DWK3_COLLN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–248； UniProt 1–248

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2iw0
Deposition date deposition_date	2006-06-23
Structure title title	Structure of the chitin deacetylase from the fungal pathogen Colletotrichum lindemuthianum
Keywords keywords	HYDROLASE, CHITIN DE-N-ACETYLASE, FAMILY 4 CARBOHYDRATE ESTERASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2iw0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2iw0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2iw0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.92 Å
Rg (electron density)	16.65 Å
Total Rg	17.55 Å
Atom count	1785
Residues	226
Excluded volume	31142 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2iw0__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	CHITIN DEACETYLASE
Molecular weight formula_weight	27904.0 kDa
EC 编号 ec_number	3.5.1.41
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1960

MHFSTLFGAAATAALAGSTNASPLARRQVPVGTPILQCTQPGLVALTYDDGPFTFTPQLLDILKQNDVRATFFVNGNNWANIEAGSNPDTIRRMRADGHLVGSHTYAHPDLNTLSSADRISQMRQLEEATRRIDGFAPKYMRAPYLSCDAGCQGDLGGLGYHIIDTNLDTKDYENNKPETTHLSAEKFNNELSADVGANSYIVLSHDVHEQTVVSLTQKLIDTLKSKGYRAVTVGECLGDAPENWYKAHHHHHH

Source Source

Source organism organism	COLLETOTRICHUM LINDEMUTHIANUM
Common name common_name	GLOMERELLA LINDEMUTHIANA
NCBI taxonomy ID ncbi_taxonomy_id	290576
Host organism host_organism	PICHIA PASTORIS

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	175

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2iw0a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.6 — 7-stranded beta/alpha barrel
Superfamily Superfamily superfamily	c.6.2 — Glycoside hydrolase/deacetylase
Family Family family	c.6.2.3 — NodB-like polysaccharide deacetylase

Domain ID domain_id	d2iw0a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	2iw0A01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	370 — Glycoside hydrolase/deacetylase

▶

Unit-cell length a length_a	71.275 Å
Unit-cell length b length_b	55.022 Å
Unit-cell length c length_c	60.057 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.810 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1740
R_work r_work	0.1720
R_free r_free	0.2150

Structure of the chitin deacetylase from the fungal pathogen Colletotrichum lindemuthianum

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHITIN DEACETYLASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2iw0__assembly_1__model_1

2iw0__assembly_1__model_1 | I(q)

2iw0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Structure of the chitin deacetylase from the fungal pathogen Colletotrichum lindemuthianum

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHITIN DEACETYLASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2iw0__assembly_1__model_1

2iw0__assembly_1__model_1 | I(q)

2iw0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

7. Citations (1)