SAXSdb — 2izx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAMP-DEPENDENT PROTEIN KINASE TYPE II-ALPHA REGULATORY SUBUNIT

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 3–43 Chain B； UniProt 3–43	Fragment：3-43	AKAP-IS × 1 DTD DITHIANE DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.5；1 M TRI-SODIUM CITRATE, 0.1 M TRIS-HCL PH 7.5	Resolution 1.30 Å R-free 0.194

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2IZX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to AML1-ETO activity Deposited 2010-05-25	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–45（45 aa） Chain B 1–45（45 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4；303 K；Ionic strength (raw mmCIF value) 0.0；Pressure ambient NMR sample composition 2 mM [U-99% 13C; U-99% 15N] NHR3, 2 mM [U-99% 13C; U-99% 15N] PKA(RIIa), 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 2–44（43 aa） Chain B 2–44（43 aa）	Not recorded	CD CADMIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 2–44（43 aa） Chain D 2–44（43 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 2–44（43 aa） Chain F 2–44（43 aa）	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 2–44（43 aa） Chain H 2–44（43 aa）	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 2–44（43 aa） Chain J 2–44（43 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
4ZP3 AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA Deposited 2015-05-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 2–44（43 aa） Chain L 2–44（43 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG3350, Cadmium chloride, Sodium acetate	Resolution 2.63 Å R-free 0.268
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain B 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain D 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain F 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain H 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain J 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H77 Crystal structure of the PKA-protein A fusion protein Deposited 2016-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain K 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268 Chain L 5–41（37 aa） Fragment：UNP RESIDUES 5-41,UNP RESIDUES 220-268	Mutation：G222A, G240A Mutation：G222A, G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.5；296 K；0.1M sodium acetate pH 4.5, 0.68M sodium citrate pH 4.5	Resolution 3.20 Å R-free 0.284
5H78 Crystal structure of the PKA-DHR14 fusion protein Deposited 2016-11-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 5–41（37 aa） Fragment：RESIDUES 4-40 (UNP RESIDUES 5-41),RESIDUES 41-196 Chain B 5–41（37 aa） Fragment：RESIDUES 4-40 (UNP RESIDUES 5-41),RESIDUES 41-196	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；296 K；0.05M sodium cacodylate pH 6.5, 0.01M magnesium chloride, 0.2M potassium chloride, 12%(w/v) PEG 4000	Resolution 2.00 Å R-free 0.207
5XBY Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion) Deposited 2017-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 5–44（40 aa） Fragment：UNP RESIDUES 5-44,UNP RESIDUES 217-269 Chain B 5–44（40 aa） Fragment：UNP RESIDUES 5-44,UNP RESIDUES 217-269	Mutation：G240A Mutation：G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；296 K；100mM Tris pH 8.5, 2.16M Sodium formate	Resolution 3.25 Å R-free 0.307
5XBY Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion) Deposited 2017-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 5–44（40 aa） Fragment：UNP RESIDUES 5-44,UNP RESIDUES 217-269 Chain D 5–44（40 aa） Fragment：UNP RESIDUES 5-44,UNP RESIDUES 217-269	Mutation：G240A Mutation：G240A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；296 K；100mM Tris pH 8.5, 2.16M Sodium formate	Resolution 3.25 Å R-free 0.307
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and Docking Domain Complex with Microtubule Associated Protein 2c (84-111) Deposited 2024-03-06	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–48（48 aa） Fragment：N-terminal docking and dimerization domain, residues 1-52 Chain B 1–48（48 aa） Fragment：N-terminal docking and dimerization domain, residues 1-52	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.9；300.2 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 0.5 mM [U-13C; U-15N] Microtubule associated protein 2c, 2 mM cAMP-dependent protein kinase type II-alpha regulatory subunit, 50 mM MOPS, 100 mM sodium chloride, 10 % v/v D2O, 17 mM sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.56 mM Microtubule associated protein 2c, 1.12 mM [U-13C; U-15N] cAMP-dependent protein kinase type II-alpha regulatory subunit, 50 mM MOPS, 100 mM sodium chloride, 10 % v/v D2O, 10 mM sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.1 mM [U-15N] Microtubule associated protein 2c, 0.4 mM cAMP-dependent protein kinase type II-alpha regulatory subunit, 50 mM MOPS, 100 mM sodium chloride, 8 % v/v D2O, 40 mg/mL Pf1 phage, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.23 mM [U-15N] Microtubule associated protein 2c, 0.92 mM cAMP-dependent protein kinase type II-alpha regulatory subunit, 50 mM MOPS, 100 mM sodium chloride, 7.5 % v/v D2O, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.45 mM I,V-13C; I,L,V-15N Microtubule associated protein 2c, 1.8 mM cAMP-dependent protein kinase type II-alpha regulatory subunit, 50 mM MOPS, 100 mM sodium chloride, 7.5 % v/v D2O, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9NXN Crystal structure of CN:RII alpha Deposited 2025-03-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 44–103（60 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；289 K；0.1 M sodium citrate pH 5.0, 0.1 M Magnesium chloride hexahydrate, 15% PEG 4000	Resolution 2.10 Å R-free 0.250

7 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KAP2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–41； UniProt 3–43 Author chain B； PDBConstruct 1–41； UniProt 3–43

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2izx
Deposition date deposition_date	2006-07-27
Structure title title	Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
Keywords keywords	CAMP-BINDING, PHOSPHORYLATION, NUCLEOTIDE-BINDING, PKA, CAMP, AKAP, ANCHOR, KINASE, ACETYLATION, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.29 Å
Radius of gyration Rg (electron density) rg_electron	12.71 Å
Forward intensity I(0) i0	2601120.00
Molecular weight molecular_weight	11596.0 kDa
Excluded volume excluded_volume	14736 Å³
Envelope volume envelope_volume	15946 Å³
Hydration-shell volume shell_volume	10693 Å³
Envelope diameter envelope_diameter	42.0 Å
Shell Rg shell_rg	18.38 Å
Envelope Rg envelope_rg	13.00 Å
Shape Rg shape_rg	12.68 Å
Total Rg total_rg	14.11 Å
Total atoms total_atoms	816
Residues n_residues	98
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	43.6 Å
Rg (real space) rg_real	14.17 Å
Rg uncertainty (real space) rg_real_error	0.28 Å
I(0) (real space) i0_real	2.6010e+06
I(0) uncertainty (real space) i0_real_error	3.1680e+04
Rg (reciprocal space) rg_reciprocal	14.18 Å
I(0) (reciprocal space) i0_reciprocal	2601000.0000
Solution quality estimate total_estimate	0.8944
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	42.5 Å
Skewness Skewness skewness	0.013
Kurtosis Kurtosis kurtosis	-0.412
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	440000.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.887; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.979; Smooth: 0.984

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	CAMP-DEPENDENT PROTEIN KINASE TYPE II-ALPHA REGULATORY SUBUNIT
Molecular weight formula_weight	4790.5 kDa
EC 编号 ec_number	2.7.11.11
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	915

IQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	AKAP-IS
Molecular weight formula_weight	2075.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

QIEYLAKQIVDNAIQQAK

Entity 3 Entity 3 non-polymer

Description description	DITHIANE DIOL
Molecular weight formula_weight	152.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	99

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2izxa_
Class class	a — All alpha proteins
Fold Fold fold	a.31 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
Superfamily Superfamily superfamily	a.31.1 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
Family Family family	a.31.1.1 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit

Domain ID domain_id	d2izxb_
Class class	a — All alpha proteins
Fold Fold fold	a.31 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
Superfamily Superfamily superfamily	a.31.1 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
Family Family family	a.31.1.1 — Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit

CATH v4.4 (1 domains)

Domain ID domain_id	2izxB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	890 — cAMP-dependent Protein Kinase, Chain A
Homologous superfamily homologous superfamily	10 — cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	41.352 Å
Unit-cell length b length_b	45.251 Å
Unit-cell length c length_c	56.837 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	28.420 Å
R factor r_factor	0.1660
R_work r_work	0.1640
R_free r_free	0.1940

fit	/app/data/saxs_computation/iz/2izx/2izx.fit
pddf	/app/data/pr_computation/iz/2izx/2izx.pr.out
profile	/app/data/saxs_computation/iz/2izx/2izx.dat

Molecular Basis of AKAP Specificity for PKA Regulatory Subunits

1. Protein Identity and Related Structures Protein Identity & Related Structures

CAMP-DEPENDENT PROTEIN KINASE TYPE II-ALPHA REGULATORY SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)