2j1k

CAV-2 fibre head in complex with CAR D1

Method: X-RAY DIFFRACTION D_max: 201.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain J； UniProt 15–140 Chain P； UniProt 15–140 Chain T； UniProt 15–140	Fragment：D1 DOMAIN, RESIDUES 15-140	FIBER PROTEIN × 3 （Q65914）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain B； UniProt 15–140 Chain K； UniProt 15–140 Chain O； UniProt 15–140	Fragment：D1 DOMAIN, RESIDUES 15-140	FIBER PROTEIN × 3 （Q65914）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
3	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain V； UniProt 15–140 Chain X； UniProt 15–140 Chain Y； UniProt 15–140	Fragment：D1 DOMAIN, RESIDUES 15-140	FIBER PROTEIN × 3 （Q65914）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 15–140 Chain G； UniProt 15–140 Chain Z； UniProt 15–140	Fragment：D1 DOMAIN, RESIDUES 15-140	FIBER PROTEIN × 3 （Q65914）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2J1K	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EAJ DIMERIC STRUCTURE OF THE COXSACKIE VIRUS AND ADENOVIRUS RECEPTOR D1 DOMAIN AT 1.35 ANGSTROM RESOLUTION Deposited 2001-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–140（126 aa） Fragment：D1 DOMAIN RESIDUES 15-140 Chain B 15–140（126 aa） Fragment：D1 DOMAIN RESIDUES 15-140	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；AMMONIUM SULPHATE, SODIUM CITRATE, GLYCEROL, pH 5.60	Resolution 1.35 Å R-free 0.148
1F5W DIMERIC STRUCTURE OF THE COXSACKIE VIRUS AND ADENOVIRUS RECEPTOR D1 DOMAIN Deposited 2000-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–140（126 aa） Fragment：D1 DOMAIN Chain B 15–140（126 aa） Fragment：D1 DOMAIN	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；ammonium sulphate, sodium citrate, glycerol, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.70 Å R-free 0.193
1F5W DIMERIC STRUCTURE OF THE COXSACKIE VIRUS AND ADENOVIRUS RECEPTOR D1 DOMAIN Deposited 2000-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 15–140（126 aa） Fragment：D1 DOMAIN Chain B 15–140（126 aa） Fragment：D1 DOMAIN	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；ammonium sulphate, sodium citrate, glycerol, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.70 Å R-free 0.193
1JEW CRYO-EM STRUCTURE OF COXSACKIEVIRUS B3(M STRAIN) WITH ITS CELLULAR RECEPTOR, COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR (CAR). Deposited 2001-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain R 21–140（120 aa） Fragment：Residues 21-140	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions CVB3 WAS INCUBATED WITH CAR SAMPLE FOR 1 HOURS AT 25 DEGREES CELSIUS (298 KELVIN) USING A FOUR-FOLD EXCESS OF CAR FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；298 K；WARNING: THIS IS AN CRYO-ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE PDB FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION, temperature 298K	Resolution 22.00 Å
1JEW CRYO-EM STRUCTURE OF COXSACKIEVIRUS B3(M STRAIN) WITH ITS CELLULAR RECEPTOR, COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR (CAR). Deposited 2001-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 21–140（120 aa） Fragment：Residues 21-140	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions CVB3 WAS INCUBATED WITH CAR SAMPLE FOR 1 HOURS AT 25 DEGREES CELSIUS (298 KELVIN) USING A FOUR-FOLD EXCESS OF CAR FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；298 K；WARNING: THIS IS AN CRYO-ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE PDB FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION, temperature 298K	Resolution 22.00 Å
1JEW CRYO-EM STRUCTURE OF COXSACKIEVIRUS B3(M STRAIN) WITH ITS CELLULAR RECEPTOR, COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR (CAR). Deposited 2001-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain R 21–140（120 aa） Fragment：Residues 21-140	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions CVB3 WAS INCUBATED WITH CAR SAMPLE FOR 1 HOURS AT 25 DEGREES CELSIUS (298 KELVIN) USING A FOUR-FOLD EXCESS OF CAR FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；298 K；WARNING: THIS IS AN CRYO-ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE PDB FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION, temperature 298K	Resolution 22.00 Å
1JEW CRYO-EM STRUCTURE OF COXSACKIEVIRUS B3(M STRAIN) WITH ITS CELLULAR RECEPTOR, COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR (CAR). Deposited 2001-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain R 21–140（120 aa） Fragment：Residues 21-140	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions CVB3 WAS INCUBATED WITH CAR SAMPLE FOR 1 HOURS AT 25 DEGREES CELSIUS (298 KELVIN) USING A FOUR-FOLD EXCESS OF CAR FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；298 K；WARNING: THIS IS AN CRYO-ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE PDB FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION, temperature 298K	Resolution 22.00 Å
1JEW CRYO-EM STRUCTURE OF COXSACKIEVIRUS B3(M STRAIN) WITH ITS CELLULAR RECEPTOR, COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR (CAR). Deposited 2001-06-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 21–140（120 aa） Fragment：Residues 21-140	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions CVB3 WAS INCUBATED WITH CAR SAMPLE FOR 1 HOURS AT 25 DEGREES CELSIUS (298 KELVIN) USING A FOUR-FOLD EXCESS OF CAR FOR EACH OF THE SIXTY POSSIBLE BINDING SITES PER VIRION. AFTER INCUBATION, SAMPLES WERE PREPARED AS THIN LAYERS OF VITREOUS ICE AND MAINTAINED AT NEAR LIQUID NITROGEN TEMPERATURE IN THE ELECTRON MICROSCOPE WITH A GATAN 626 CRYOTRANSFER HOLDER. X-ray crystallization conditions ELECTRON MICROSCOPY RECONSTRUCTION；pH 7.5；298 K；WARNING: THIS IS AN CRYO-ELECTRON MICROSCOPY MODEL DEPOSITION. CRYO-EM INFORMATION HAS BEEN INCLUDED IN THE PDB FILE., pH 7.5, ELECTRON MICROSCOPY RECONSTRUCTION, temperature 298K	Resolution 22.00 Å
1KAC KNOB DOMAIN FROM ADENOVIRUS SEROTYPE 12 IN COMPLEX WITH DOMAIN 1 OF ITS CELLULAR RECEPTOR CAR Deposited 1999-05-05	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 21–144（124 aa） Fragment：DOMAIN 1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；900MM AMMONIUM SULPHATE ON 100MM MES, PH 6.2	Resolution 2.60 Å R-free 0.250
1P69 STRUCTURAL BASIS FOR VARIATION IN ADENOVIRUS AFFINITY FOR THE CELLULAR RECEPTOR CAR (P417S MUTANT) Deposited 2003-04-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 22–144（123 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；VAPOR DIFFUSION, SITTING DROP	Resolution 3.10 Å R-free 0.256
1P6A STRUCTURAL BASIS FOR VARIATION IN ADENOVIRUS AFFINITY FOR THE CELLULAR RECEPTOR CAR (S489Y MUTANT) Deposited 2003-04-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 22–144（123 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.90 Å R-free 0.252
1RSF NMR Structure of Monomeric CAR d1 domain Deposited 2003-12-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 21–144（124 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 3；298 K；Ionic strength (raw mmCIF value) 100 mM；Pressure ambient NMR sample composition U-15N \| 90% H2O/10% D2O NMR sample composition U-13C/U-15N \| 90% H2O/10% D2O	Resolution not provided
2J12 Ad37 fibre head in complex with CAR D1 Deposited 2006-08-08	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 15–140（126 aa） Fragment：DOMAIN D1, RESIDUES 15-140	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å R-free 0.169
2NPL NMR Structure of CARD d2 Domain Deposited 2006-10-27	Different construct Different mutation/modification Different oligomeric state Different experimental method Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 142–235（94 aa） Fragment：Domain CAR 2	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain G 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain Z 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain K 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain O 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain J 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain P 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain T 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain V 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain X 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139 Chain Y 16–139（124 aa） Fragment：DOMAIN D1, RESIDUES 16-139	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2WBW Ad37 fibre head in complex with CAR D1 and sialic acid Deposited 2009-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 15–140（126 aa） Fragment：D1, RESIDUES 15-140	Not recorded	SIA N-acetyl-alpha-neuraminic acid × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 17% POLYETHYLENE GLYCOL 6000, 0.5 M LICL, 0.1 M TRIS, PH 8	Resolution 1.55 Å R-free 0.176
3J6L Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-MERIC	Chain B 15–140（126 aa） Fragment：UNP residues 15-140	Not recorded	SO4 SULFATE ION × 120	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6L Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 15–140（126 aa） Fragment：UNP residues 15-140	Not recorded	SO4 SULFATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6L Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain B 15–140（126 aa） Fragment：UNP residues 15-140	Not recorded	SO4 SULFATE ION × 10	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6L Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 15–140（126 aa） Fragment：UNP residues 15-140	Not recorded	SO4 SULFATE ION × 12	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6L Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 15–140（126 aa） Fragment：UNP residues 15-140	Not recorded	SO4 SULFATE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6M Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-MERIC	Chain B 21–144（124 aa） Fragment：UNP residues 21-144	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6M Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 21–144（124 aa） Fragment：UNP residues 21-144	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6M Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain B 21–144（124 aa） Fragment：UNP residues 21-144	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6M Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain B 21–144（124 aa） Fragment：UNP residues 21-144	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
3J6M Kinetic and Structural Analysis of Coxsackievirus B3 Receptor Interactions and Formation of the A-particle Deposited 2014-03-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 21–144（124 aa） Fragment：UNP residues 21-144	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 50 mM MES, 100 mM NaCl；pH 6；50 mM MES, 100 mM NaCl cryo-EM vitrification conditions 95 K；Cryogen OTHER；Plunged into ethane-propane (FEI VITROBOT MARK III)	Resolution 9.00 Å
7DPZ Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DPZ Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DPZ Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DPZ Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DPZ Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7DQ1 Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR at physiological temperature Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7DQ1 Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR at physiological temperature Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7DQ1 Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR at physiological temperature Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7DQ1 Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR at physiological temperature Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7DQ1 Cryo-EM structure of Coxsackievirus B1 virion in complex with CAR at physiological temperature Deposited 2020-12-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 20–140（121 aa） Fragment：D1 domain	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7VXZ Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7VXZ Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7VXZ Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7VXZ Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7VXZ Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
7VYK Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 21–236（216 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYK Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYK Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain E 21–236（216 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYK Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 21–236（216 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYK Coxsackievirus B3 at pH7.4 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYL Coxsackievirus B3 at pH5.5 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYL Coxsackievirus B3 at pH5.5 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYL Coxsackievirus B3 at pH5.5 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYL Coxsackievirus B3 at pH5.5 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYL Coxsackievirus B3 at pH5.5 (VP3-234Q) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7VYM Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
7VYM Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
7VYM Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
7VYM Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
7VYM Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 10min Deposited 2021-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å
7W14 Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7W14 Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7W14 Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7W14 Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7W14 Coxsackievirus B3 at pH7.4 (VP3-234E) incubation with coxsackievirus and adenovirus receptor for 20min Deposited 2021-11-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 21–236（216 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å

20 other PDB entries and 64 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CXAR_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–128； UniProt 15–140 Author chain B； PDBConstruct 3–128； UniProt 15–140 Author chain G； PDBConstruct 3–128； UniProt 15–140 Author chain J； PDBConstruct 3–128； UniProt 15–140 Author chain K； PDBConstruct 3–128； UniProt 15–140 Author chain O； PDBConstruct 3–128； UniProt 15–140 Author chain P； PDBConstruct 3–128； UniProt 15–140 Author chain T； PDBConstruct 3–128； UniProt 15–140 Author chain V； PDBConstruct 3–128； UniProt 15–140 Author chain X； PDBConstruct 3–128； UniProt 15–140 Author chain Y； PDBConstruct 3–128； UniProt 15–140 Author chain Z； PDBConstruct 3–128； UniProt 15–140

FIBER PROTEIN

CANINE ADENOVIRUS 2

UniProt Q65914

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain C； UniProt 358–542 Chain H； UniProt 358–542 Chain I； UniProt 358–542	Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR × 3 （P78310）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 358–542 Chain E； UniProt 358–542 Chain F； UniProt 358–542	Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR × 3 （P78310）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
3	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain L； UniProt 358–542 Chain M； UniProt 358–542 Chain N； UniProt 358–542	Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR × 3 （P78310）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain Q； UniProt 358–542 Chain R； UniProt 358–542 Chain S； UniProt 358–542	Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR × 3 （P78310）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.30 Å R-free 0.220

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2J1K	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2J2J Canine adenovirus fibre head at 1.5 A resolution Deposited 2006-08-16	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542 Chain B 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542 Chain D 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.15 M KBR, 30% PEG MONOMETHYL-ETHER 2000	Resolution 1.50 Å R-free 0.206
2J2J Canine adenovirus fibre head at 1.5 A resolution Deposited 2006-08-16	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain C 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542 Chain E 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542 Chain F 358–542（185 aa） Fragment：FIBRE HEAD DOMAIN, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.15 M KBR, 30% PEG MONOMETHYL-ETHER 2000	Resolution 1.50 Å R-free 0.206
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain Q 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain R 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain S 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain E 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain F 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain H 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain I 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2W9L CANINE ADENOVIRUS TYPE 2 FIBRE HEAD IN COMPLEX WITH CAR DOMAIN D1 AND SIALIC ACID Deposited 2009-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain M 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain N 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 20% POLYETHYLENE GLYCOL MONOMETHYL-ETHER 550, 0.1 M BICINE, PH 9, 0.1 M NACL	Resolution 2.91 Å R-free 0.254
2WBV Canine adenovirus 2 fibre head in complex with sialic acid Deposited 2009-03-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain B 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain D 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	GOL GLYCEROL × 3 SIA N-acetyl-alpha-neuraminic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions 5% PEG 4000, 5% ISOPROPANOL, 0.1 M HEPES PH 7.4	Resolution 1.90 Å R-free 0.195
2WBV Canine adenovirus 2 fibre head in complex with sialic acid Deposited 2009-03-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain C 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain E 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542 Chain F 358–542（185 aa） Fragment：FIBRE HEAD, RESIDUES 358-542	Not recorded	GOL GLYCEROL × 3 SIA N-acetyl-alpha-neuraminic acid × 3	X-RAY DIFFRACTION X-ray crystallization conditions 5% PEG 4000, 5% ISOPROPANOL, 0.1 M HEPES PH 7.4	Resolution 1.90 Å R-free 0.195

3 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FIBP_ADECT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 13–197； UniProt 358–542 Author chain D； PDBConstruct 13–197； UniProt 358–542 Author chain E； PDBConstruct 13–197； UniProt 358–542 Author chain F； PDBConstruct 13–197； UniProt 358–542 Author chain H； PDBConstruct 13–197； UniProt 358–542 Author chain I； PDBConstruct 13–197； UniProt 358–542 Author chain L； PDBConstruct 13–197； UniProt 358–542 Author chain M； PDBConstruct 13–197； UniProt 358–542 Author chain N； PDBConstruct 13–197； UniProt 358–542 Author chain Q； PDBConstruct 13–197； UniProt 358–542 Author chain R； PDBConstruct 13–197； UniProt 358–542 Author chain S； PDBConstruct 13–197； UniProt 358–542

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2j1k
Deposition date deposition_date	2006-08-14
Structure title title	CAV-2 fibre head in complex with CAR D1
Keywords keywords	;VIRUS-RECEPTOR COMPLEX, COMPLEX, MEMBRANE, RECEPTOR, PALMITATE, DOMAIN D1, IMMUNOGLOBULIN DOMAIN, HOST-VIRUS INTERACTION, GLYCOPROTEIN, FIBER PROTEIN, CELL ADHESION, PHOSPHORYLATION, TRANSMEMBRANE, TIGHT JUNCTION, COXSACKIEVIRUS, FIBER HEAD, ADENOVIRUS, FIBRE HEAD, LIPOPROTEIN, CAR, KNOB, FIBER, FIBRE, CAV-2, CANINE ;; VIRUS/RECEPTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	58.46 Å
Radius of gyration Rg (electron density) rg_electron	58.78 Å
Forward intensity I(0) i0	2213870000.00
Molecular weight molecular_weight	399450.0 kDa
Excluded volume excluded_volume	501760 Å³
Envelope volume envelope_volume	696720 Å³
Hydration-shell volume shell_volume	102860 Å³
Envelope diameter envelope_diameter	212.3 Å
Shell Rg shell_rg	57.60 Å
Envelope Rg envelope_rg	57.77 Å
Shape Rg shape_rg	58.77 Å
Total Rg total_rg	58.77 Å
Total atoms total_atoms	28097
Residues n_residues	3623
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	201.5 Å
Rg (real space) rg_real	58.71 Å
Rg uncertainty (real space) rg_real_error	2.97 Å
I(0) (real space) i0_real	2.2140e+09
I(0) uncertainty (real space) i0_real_error	4.8310e+07
Rg (reciprocal space) rg_reciprocal	58.23 Å
I(0) (reciprocal space) i0_reciprocal	2212000000.0000
Solution quality estimate total_estimate	0.8541
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	67.2 Å
Skewness Skewness skewness	0.454
Kurtosis Kurtosis kurtosis	-0.249
Angular range angular_range	— – 0.1350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	131300000.0000
Real-space data points n_real_points	28
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.830; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.972; Smooth: 0.642

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR
Molecular weight formula_weight	14251.2 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,G,J,K,O,P,T,V,X,Y,Z
Atom count atom_count	29978

MADFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVK

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	FIBER PROTEIN
Molecular weight formula_weight	21685.5 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,H,I,L,M,N,Q,R,S

MRGSHHHHHHGSPPAAPITLWTGPGPSINGFINDTPVIRCFICLTRDSNLVTVNASFVGEGGYRIVSPTQSQFSLIMEFDQFGQLMSTGNINSTTTWGEKPWGNNTVQPRPSHTWKLCMPNREVYSTPAATISRCGLDSIAVDGAPSRSIDCMLIINKPKGVATYTLTFRFLNFNRLSGGTLFKTDVLTFTYVGENQ

来源 Source

来源生物 organism	CANINE ADENOVIRUS 2
NCBI Class编号 ncbi_taxonomy_id	10514
宿主生物 host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1881

▼

7. Fold Classification (SCOP + CATH) 48 domains

SCOP 2.08 (24 domains)

Domain ID domain_id	d2j1ka_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kc1
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kd_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1ke_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kf_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kg_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kh_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1ki_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kj_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kk_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kl_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1km_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kn_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1ko_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kp_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kq_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kr_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1ks_
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.1 — Adenovirus fiber protein 'knob' domain

Domain ID domain_id	d2j1kt_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kv_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kx_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1ky_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2j1kz_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

CATH v4.4 (24 domains)

Domain ID domain_id	2j1kA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kM00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kN00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kO00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kP00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kQ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kR00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	2j1kT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kV00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kX00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kY00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2j1kZ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	219.940 Å
Unit-cell length b length_b	219.940 Å
Unit-cell length c length_c	387.530 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	192

Space group space_group	I 4 2 2
Space-group number int_tables_number	97
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	192.450 Å
R factor r_factor	0.1720
R_work r_work	0.1720
R_free r_free	0.2200

CAV-2 fibre head in complex with CAR D1

1. Protein Identity and Related Structures Protein Identity & Related Structures

COXSACKIEVIRUS AND ADENOVIRUS RECEPTOR

State in the Current Structure

Other States of the Same Protein in the Database

FIBER PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 48 domains

SCOP 2.08 (24 domains)

CATH v4.4 (24 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)

fit	/app/data/saxs_computation/j1/2j1k/2j1k.fit
pddf	/app/data/pr_computation/j1/2j1k/2j1k.pr.out
profile	/app/data/saxs_computation/j1/2j1k/2j1k.dat