2j58

The structure of Wza

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

OUTER MEMBRANE LIPOPROTEIN WZA

ESCHERICHIA COLI

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	N-OCTANE × 8 HEXANE × 8 SULFATE ION × 16 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X4B7_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–359； UniProt 21–379 Author chain B； PDBConstruct 1–359； UniProt 21–379 Author chain C； PDBConstruct 1–359； UniProt 21–379 Author chain D； PDBConstruct 1–359； UniProt 21–379 Author chain E； PDBConstruct 1–359； UniProt 21–379 Author chain F； PDBConstruct 1–359； UniProt 21–379 Author chain G； PDBConstruct 1–359； UniProt 21–379 Author chain H； PDBConstruct 1–359； UniProt 21–379

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2j58
Deposition date deposition_date	2006-09-12
Structure title title	The structure of Wza
Keywords keywords	MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2j58__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2j58__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2j58__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.42 Å
Rg (electron density)	44.17 Å
Total Rg	44.28 Å
Atom count	22232
Residues	2760
Excluded volume	398110 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2j58__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	OUTER MEMBRANE LIPOPROTEIN WZA
Molecular weight formula_weight	40100.8 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	23866

XTIIPGQGLNSLRKNVVELPDSDYDLDKLVNVYPMTPGLIDQLRPEPVIARSNPQLDNLLKSYEYRIGVGDVLMVTVWDHPELTTPAGQYRSASDTGNWVNSDGTIFYPYIGKVQVAGKTVSQVRQDITSRLTTYIESPQVDVSIAAFRSQKVYVTGEVANSGKQAITNIPLTVMDAINAAGGLAADADWRNVVLTHNGKDTKISLYALMQKGDLTQNHLLYHGDILFIPSNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGISQEMSDATGIFVVRQLKGDRTGKIADIYQLNAQDASAMVLGTEFQLQPYDIVYVTTAPLVRWNRVISQLVPTISGVHDMTETVRYIKRWPN

Source Source

Source organism organism	ESCHERICHIA COLI
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	N-OCTANE
Molecular weight formula_weight	114.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 non-polymer

Description description	HEXANE
Molecular weight formula_weight	86.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1634

▼

6. Fold Classification (SCOP + CATH) 32 domains

CATH v4.4 (32 domains)

Domain ID domain_id	2j58A01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58A02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58A03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58A04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58B01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58B02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58B03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58B04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58C01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58C02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58C03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58C04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58D01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58D02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58D03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58D04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58E01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58E02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58E03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58E04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58F01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58F02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58F03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58F04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58G01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58G02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58G03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58G04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	2j58H01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58H02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	560 — Outer membrane lipoprotein wza fold like
Homologous superfamily homologous superfamily	10 — Outer membrane lipoprotein wza domain like

Domain ID domain_id	2j58H03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1950 — wza like fold
Homologous superfamily homologous superfamily	10 — wza like domain

Domain ID domain_id	2j58H04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	70 —

▶

Unit-cell length a length_a	94.719 Å
Unit-cell length b length_b	215.268 Å
Unit-cell length c length_c	220.892 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	107.830 Å
R factor r_factor	0.1900
R_work r_work	0.1880
R_free r_free	0.2260

The structure of Wza

1. Protein Identity and Related Structures Protein Identity & Related Structures

OUTER MEMBRANE LIPOPROTEIN WZA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2j58__assembly_1__model_1

2j58__assembly_1__model_1 | I(q)

2j58__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 32 domains

CATH v4.4 (32 domains)

7. Citations (1)

The structure of Wza

1. Protein Identity and Related Structures Protein Identity & Related Structures

OUTER MEMBRANE LIPOPROTEIN WZA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2j58__assembly_1__model_1

2j58__assembly_1__model_1 | I(q)

2j58__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 32 domains

CATH v4.4 (32 domains)

7. Citations (1)