SAXSdb — 2jb7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN PAE2307

PYROBACULUM AEROPHILUM

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	ADENOSINE MONOPHOSPHATE × 6 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 6 ACETATE ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8ZVF7_PYRAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–164； UniProt 1–164 Author chain B； PDBConstruct 1–164； UniProt 1–164 Author chain C； PDBConstruct 1–164； UniProt 1–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jb7
Deposition date deposition_date	2006-12-04
Structure title title	PAE2307 with AMP
Keywords keywords	HYPOTHETICAL PROTEIN, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2jb7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2jb7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2jb7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.32 Å
Rg (electron density)	27.01 Å
Total Rg	28.03 Å
Atom count	7888
Residues	976
Excluded volume	141960 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2jb7__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	HYPOTHETICAL PROTEIN PAE2307
Molecular weight formula_weight	18322.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	4279

MSIKFELIDVPIPQGTNVIIGQAHFIKTVEDLYEALVTSVPGVKFGIAFCEASGKRLVRHEANDEELRNLAIDLCKKIAAGHVFVIYIRNAWPINVLNAIKNVPEVVRIFAATANPLKVIVAEVEPERRGVVGVVDGHSPLGVETEKDREERKKFLREVVKYKL

Source Source

Source organism organism	PYROBACULUM AEROPHILUM
NCBI taxonomy ID ncbi_taxonomy_id	13773
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	ADENOSINE MONOPHOSPHATE
Molecular weight formula_weight	347.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	312

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2jb7a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.256 — Ta1353-like
Superfamily Superfamily superfamily	d.256.1 — Ta1353-like
Family Family family	d.256.1.0 — automated matches

Domain ID domain_id	d2jb7b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.256 — Ta1353-like
Superfamily Superfamily superfamily	d.256.1 — Ta1353-like
Family Family family	d.256.1.0 — automated matches

Domain ID domain_id	d2jb7c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.256 — Ta1353-like
Superfamily Superfamily superfamily	d.256.1 — Ta1353-like
Family Family family	d.256.1.0 — automated matches

CATH v4.4 (3 domains)

Domain ID domain_id	2jb7A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1520 — hypothetical protein tt1634
Homologous superfamily homologous superfamily	10 — Ta1353-like

Domain ID domain_id	2jb7B00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1520 — hypothetical protein tt1634
Homologous superfamily homologous superfamily	10 — Ta1353-like

Domain ID domain_id	2jb7C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1520 — hypothetical protein tt1634
Homologous superfamily homologous superfamily	10 — Ta1353-like

▶

Unit-cell length a length_a	120.133 Å
Unit-cell length b length_b	120.133 Å
Unit-cell length c length_c	156.251 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 41 2 2
Space-group number int_tables_number	98
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	95.350 Å
R factor r_factor	0.1720
R_work r_work	0.1690
R_free r_free	0.2010

PAE2307 with AMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN PAE2307

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jb7__assembly_1__model_1

2jb7__assembly_1__model_1 | I(q)

2jb7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

PAE2307 with AMP

1. Protein Identity and Related Structures Protein Identity & Related Structures

HYPOTHETICAL PROTEIN PAE2307

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jb7__assembly_1__model_1

2jb7__assembly_1__model_1 | I(q)

2jb7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)