SAXSdb — 2jki

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CYTOSOLIC HEAT SHOCK PROTEIN 90

HORDEUM VULGARE

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	SGT1-LIKE PROTEIN × 1 （Q84LL4） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	SGT1-LIKE PROTEIN × 1 （Q84LL4） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	SGT1-LIKE PROTEIN × 1 （Q84LL4） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7XJ80_HORVU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–223； UniProt 1–217 Author chain B； PDBConstruct 7–223； UniProt 1–217 Author chain C； PDBConstruct 7–223； UniProt 1–217

SGT1-LIKE PROTEIN

ARABIDOPSIS THALIANA

UniProt Q84LL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	CYTOSOLIC HEAT SHOCK PROTEIN 90 × 1 （Q7XJ80） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	CYTOSOLIC HEAT SHOCK PROTEIN 90 × 1 （Q7XJ80） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	CYTOSOLIC HEAT SHOCK PROTEIN 90 × 1 （Q7XJ80） ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84LL4_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain S； PDBConstruct 1–90； UniProt 74–163 Author chain T； PDBConstruct 1–90； UniProt 74–163 Author chain U； PDBConstruct 1–90； UniProt 74–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jki
Deposition date deposition_date	2008-08-28
Structure title title	Complex of Hsp90 N-terminal and Sgt1 CS domain
Keywords keywords	HSP90 SGT1, STRESS RESPONSE, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2jki__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2jki__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2jki__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.64 Å
Rg (electron density)	20.84 Å
Total Rg	21.71 Å
Atom count	2443
Residues	304
Excluded volume	43604 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2jki__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2jki__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2jki__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	CYTOSOLIC HEAT SHOCK PROTEIN 90
Molecular weight formula_weight	25261.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	7404

HHHHHHMATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLKDDQMEYLEERRIKDLVKRHSEFISYPISLWTEKTTEK

Source Source

Source organism organism	HORDEUM VULGARE
Common name common_name	BARLEY
NCBI taxonomy ID ncbi_taxonomy_id	4513
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	SGT1-LIKE PROTEIN
Molecular weight formula_weight	10340.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U

KYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHG

Source Source

Source organism organism	ARABIDOPSIS THALIANA
Common name common_name	THALE CRESS
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	2jkiA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	565 — Heat Shock Protein 90
Homologous superfamily homologous superfamily	10 — Histidine kinase-like ATPase, C-terminal domain

Domain ID domain_id	2jkiB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	565 — Heat Shock Protein 90
Homologous superfamily homologous superfamily	10 — Histidine kinase-like ATPase, C-terminal domain

Domain ID domain_id	2jkiC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	565 — Heat Shock Protein 90
Homologous superfamily homologous superfamily	10 — Histidine kinase-like ATPase, C-terminal domain

Domain ID domain_id	2jkiS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	790 —

Domain ID domain_id	2jkiT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	790 —

Domain ID domain_id	2jkiU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	790 —

▶

Unit-cell length a length_a	100.268 Å
Unit-cell length b length_b	129.654 Å
Unit-cell length c length_c	135.998 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	38.072 Å
R factor r_factor	0.2009
R_work r_work	0.1988
R_free r_free	0.2383

Complex of Hsp90 N-terminal and Sgt1 CS domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

CYTOSOLIC HEAT SHOCK PROTEIN 90

State in the Current Structure

Other States of the Same Protein in the Database

SGT1-LIKE PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jki__assembly_1__model_1

2jki__assembly_1__model_1 | I(q)

2jki__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Complex of Hsp90 N-terminal and Sgt1 CS domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

CYTOSOLIC HEAT SHOCK PROTEIN 90

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SGT1-LIKE PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jki__assembly_1__model_1

2jki__assembly_1__model_1 | I(q)

2jki__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)