SAXSdb — 2k1n

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

AbrB family transcriptional regulator

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 4 DNA 2	DNA (25-MER) × 1 DNA (25-MER) × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A063X7Z2_BACIU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–55； UniProt 1–55 Author chain B； PDBConstruct 1–55； UniProt 1–55 Author chain C； PDBConstruct 1–55； UniProt 1–55 Author chain D； PDBConstruct 1–55； UniProt 1–55

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2k1n
Deposition date deposition_date	2008-03-10
Structure title title	DNA bound structure of the N-terminal domain of AbrB
Keywords keywords	;AbrB, abrB8, DNA bound, Transition State Regulator, DNA binding protein, Activator, DNA-binding, Repressor, Sporulation, Transcription, Transcription regulation, TRANSCRIPTION-DNA COMPLEX ;; TRANSCRIPTION/DNA
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2k1n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2k1n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2k1n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.28 Å
Rg (electron density)	24.39 Å
Total Rg	25.07 Å
Atom count	5274
Residues	270
Excluded volume	47342 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2k1n__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2k1n__assembly_1__model_2`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2k1n__assembly_1__model_3`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2k1n__assembly_1__model_4`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2k1n__assembly_1__model_5`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2k1n__assembly_1__model_6`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2k1n__assembly_1__model_7`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`2k1n__assembly_1__model_8`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`2k1n__assembly_1__model_9`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`2k1n__assembly_1__model_10`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	DNA (25-MER)
Molecular weight formula_weight	7696.0 kDa
Mutation mutation	A10G
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E
Atom count atom_count	52740

ATGATTGACAATTATTGGAAACCTT

Entity 2 Entity 2 polymer

Description description	DNA (25-MER)
Molecular weight formula_weight	7656.0 kDa
Mutation mutation	A10G
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

AAGGTTTCCAATAATTGTCAATCAT

Entity 3 Entity 3 polymer

Description description	AbrB family transcriptional regulator
Molecular weight formula_weight	6342.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQ

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2k1nA00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2k1nB00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2k1nC00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2k1nD00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

▶

DNA bound structure of the N-terminal domain of AbrB

1. Protein Identity and Related Structures Protein Identity & Related Structures

AbrB family transcriptional regulator

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2k1n__assembly_1__model_1

2k1n__assembly_1__model_1 | I(q)

2k1n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)