SAXSdb — 2nmm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

14 kDa phosphohistidine phosphatase

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 3	SULFATE ION × 6 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHP14_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–135； UniProt 1–125 Author chain B； PDBConstruct 11–135； UniProt 1–125 Author chain C； PDBConstruct 11–135； UniProt 1–125

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2nmm
Deposition date deposition_date	2006-10-22
Structure title title	Crystal structure of human phosphohistidine phosphatase. Northeast Structural Genomics Consortium target HR1409
Keywords keywords	;NESG Q9H0Y3 human phosphohistidine phosphatase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, HYDROLASE ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2nmm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2nmm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2nmm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.02 Å
Rg (electron density)	13.77 Å
Total Rg	14.98 Å
Atom count	899
Residues	111
Excluded volume	15864 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2nmm__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2nmm__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2nmm__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2nmm__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	14 kDa phosphohistidine phosphatase
Molecular weight formula_weight	15281.5 kDa
EC 编号 ec_number	3.1.3.-
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	2707

MGHHHHHHSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	36

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2nmma1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.322 — PHP14-like
Superfamily Superfamily superfamily	d.322.1 — PHP14-like
Family Family family	d.322.1.1 — Janus/Ocnus

Domain ID domain_id	d2nmmb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.322 — PHP14-like
Superfamily Superfamily superfamily	d.322.1 — PHP14-like
Family Family family	d.322.1.1 — Janus/Ocnus

Domain ID domain_id	d2nmmb3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2nmmc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.322 — PHP14-like
Superfamily Superfamily superfamily	d.322.1 — PHP14-like
Family Family family	d.322.1.1 — Janus/Ocnus

CATH v4.4 (3 domains)

Domain ID domain_id	2nmmA01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	20 — Pyruvoyl-Dependent Histidine Decarboxylase; Chain B
Homologous superfamily homologous superfamily	20 — Janus/Ocnus

Domain ID domain_id	2nmmB01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	20 — Pyruvoyl-Dependent Histidine Decarboxylase; Chain B
Homologous superfamily homologous superfamily	20 — Janus/Ocnus

Domain ID domain_id	2nmmC00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	20 — Pyruvoyl-Dependent Histidine Decarboxylase; Chain B
Homologous superfamily homologous superfamily	20 — Janus/Ocnus

▶

Unit-cell length a length_a	84.685 Å
Unit-cell length b length_b	60.088 Å
Unit-cell length c length_c	79.299 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	19.910 Å
R factor r_factor	0.1940
R_work r_work	0.1940
R_free r_free	0.2610

Crystal structure of human phosphohistidine phosphatase. Northeast Structural Genomics Consortium target HR1409

1. Protein Identity and Related Structures Protein Identity & Related Structures

14 kDa phosphohistidine phosphatase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2nmm__assembly_1__model_1

2nmm__assembly_1__model_1 | I(q)

2nmm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

7. Citations (1)

Crystal structure of human phosphohistidine phosphatase. Northeast Structural Genomics Consortium target HR1409

1. Protein Identity and Related Structures Protein Identity & Related Structures

14 kDa phosphohistidine phosphatase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2nmm__assembly_1__model_1

2nmm__assembly_1__model_1 | I(q)

2nmm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

7. Citations (1)