SAXSdb — 2np2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hbb

Borrelia burgdorferi

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 2 DNA 2	36-MER × 2 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3I4Z2_BORBU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–108； UniProt 1–108 Author chain B； PDBConstruct 1–108； UniProt 1–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2np2
Deposition date deposition_date	2006-10-26
Structure title title	Hbb-DNA complex
Keywords keywords	protein-dna complex, dna-binding protein, dna-bending protein, DNABII family, HU/IHF family, DNA BINDING PROTEIN-DNA COMPLEX; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2np2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2np2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2np2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.10 Å
Rg (electron density)	22.55 Å
Total Rg	23.46 Å
Atom count	3122
Residues	276
Excluded volume	51348 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2np2__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	36-MER
Molecular weight formula_weight	11062.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,D
Atom count atom_count	3154

GTATTTAATACTATATGTCATATAGTATTAAATACT

Entity 2 Entity 2 polymer

Description description	Hbb
Molecular weight formula_weight	12694.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MSFSRRPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVWGIKG

Source Source

Source organism organism	Borrelia burgdorferi
Common name common_name	Lyme disease spirochete
NCBI taxonomy ID ncbi_taxonomy_id	139
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	32

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2np2a_
Class class	a — All alpha proteins
Fold Fold fold	a.55 — IHF-like DNA-binding proteins
Superfamily Superfamily superfamily	a.55.1 — IHF-like DNA-binding proteins
Family Family family	a.55.1.0 — automated matches

Domain ID domain_id	d2np2b_
Class class	a — All alpha proteins
Fold Fold fold	a.55 — IHF-like DNA-binding proteins
Superfamily Superfamily superfamily	a.55.1 — IHF-like DNA-binding proteins
Family Family family	a.55.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	2np2A00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	520 — HU Protein; Chain A
Homologous superfamily homologous superfamily	10 — IHF-like DNA-binding proteins

Domain ID domain_id	2np2B00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	520 — HU Protein; Chain A
Homologous superfamily homologous superfamily	10 — IHF-like DNA-binding proteins

▶

Unit-cell length a length_a	59.270 Å
Unit-cell length b length_b	88.320 Å
Unit-cell length c length_c	96.570 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.020 Å
Low-resolution limit resolution_low	28.330 Å
R factor r_factor	0.2350
R_work r_work	0.2350
R_free r_free	0.2760

Hbb-DNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hbb

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2np2__assembly_1__model_1

2np2__assembly_1__model_1 | I(q)

2np2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Hbb-DNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hbb

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2np2__assembly_1__model_1

2np2__assembly_1__model_1 | I(q)

2np2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)