SAXSdb — 2o0a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

S.cerevisiae chromosome XVI reading frame ORF YPL253c

OrganismNot specified

UniProt Q12045

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q12045_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–298； UniProt 353–647

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o0a
Deposition date deposition_date	2006-11-27
Structure title title	The structure of the C-terminal domain of Vik1 has a motor domain fold but lacks a nucleotide-binding site.
Keywords keywords	;Vik1, motor homology domain, kinesin, motor domain, microtubule-binding, Kinesin-14, heterodimer, CELL CYCLE-TRANSPORT PROTEIN COMPLEX ;; CELL CYCLE/TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2o0a__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2o0a__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2o0a__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.54 Å
Rg (electron density)	18.23 Å
Total Rg	19.36 Å
Atom count	2204
Residues	270
Excluded volume	39747 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2o0a__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	S.cerevisiae chromosome XVI reading frame ORF YPL253c
Molecular weight formula_weight	34632.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2454

GASTVEKELLRSRRLENSIIEQKGTMRCYAYVMEQNLPENLLFDYENGVITQGLSEHVYKFNRVIPHLKVSEDKFFTQEYSVYHDMCLNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDYSHNDKDSIKLKFEKHSISLDSKLVIIENGLEDLPLNFSCDEHPNLPHSGMGIIKVQFFPRDSKSDGNNDPVPVDFYFIELNNLKSIEQFDKSIFKKESCETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQLCKRKKKLT

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	241

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	2o0aA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	850 — Kinesin
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	46.524 Å
Unit-cell length b length_b	70.129 Å
Unit-cell length c length_c	79.861 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2120
R_work r_work	0.2100
R_free r_free	0.2610

The structure of the C-terminal domain of Vik1 has a motor domain fold but lacks a nucleotide-binding site.

1. Protein Identity and Related Structures Protein Identity & Related Structures

S.cerevisiae chromosome XVI reading frame ORF YPL253c

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o0a__assembly_1__model_1

2o0a__assembly_1__model_1 | I(q)

2o0a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

The structure of the C-terminal domain of Vik1 has a motor domain fold but lacks a nucleotide-binding site.

1. Protein Identity and Related Structures Protein Identity & Related Structures

S.cerevisiae chromosome XVI reading frame ORF YPL253c

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o0a__assembly_1__model_1

2o0a__assembly_1__model_1 | I(q)

2o0a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)